RegulonDB RegulonDB 10.6.3: Gene Form
   

metR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metE metR bioP yigL MetJ MetJ OxyR MetR OxyR MetR TSS_4502 TSS_4502 TSS_4501 TSS_4501 TSS_4500 TSS_4500 TSS_4499 TSS_4499 TSS_4498 TSS_4498 TSS_4497 TSS_4497 TSS_4496 TSS_4496 TSS_4495 TSS_4495 TSS_4494 TSS_4494 TSS_4493 TSS_4493 TSS_4492 TSS_4492 TSS_4491 TSS_4491 TSS_4490 TSS_4490 TSS_4489 TSS_4489 TSS_4488 TSS_4488 TSS_4487 TSS_4487 TSS_4486 TSS_4486 TSS_4485 TSS_4485 TSS_4484 TSS_4484 metEp metEp metRp1 metRp1 metRp2 metRp2 yigMp3 yigMp3

Gene      
Name: metR    Texpresso search in the literature
Synonym(s): ECK3822, EG10591, b3828
Genome position(nucleotides): 4011863 <-- 4012816 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.29
External database links:  
ASAP:
ABE-0012506
CGSC:
18163
ECHOBASE:
EB0586
ECOCYC:
EG10591
ECOLIHUB:
metR
OU-MICROARRAY:
b3828
REGULONDB:
b3828
STRING:
511145.b3828
M3D: metR
COLOMBOS: metR
PortEco: b3828


Product      
Name: DNA-binding transcriptional dual regulator MetR
Synonym(s): MetR
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LysR
Cellular location: cytosol
Molecular weight: 35.629
Isoelectric point: 8.244
Motif(s):
 
Type Positions Sequence
5 -> 63 KHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFTPQGE
1 -> 59 MIEVKHLKTLQALRNCGSLAAAAATLHQTQSALSHQFSDLEQRLGFRLFVRKSQPLRFT
19 -> 19 L
86 -> 288 PQQTRLRIAIECHSCIQWLTPALENFHKNWPQVEMDFKSGVTFDPQPALQQGELDLVMTSDILPRSGLHYSPMFDYEVRLVLAPDHPLAAKTRITPEDLASETLLIYPVQRSRLDVWRHFLQPAGVSPSLKSVDNTLLLIQMVAARMGIAALPHWVVESFERQGLVVTKTLGEGLWSRLYAAVRDGEQRQPVTEAFIRSARNH

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.9 - methionine
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0016597 - amino acid binding
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0008652 - cellular amino acid biosynthetic process
GO:0009086 - methionine biosynthetic process
Reference(s): [1] Daniels DL., et al., 1992
[2] Maxon ME., et al., 1989
[3] Maxon ME., et al., 1990
External database links:  
DIP:
DIP-10198N
ECOCYC:
PD03938
ECOLIWIKI:
b3828
INTERPRO:
IPR000847
INTERPRO:
IPR037406
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR005119
MINT:
MINT-1262668
MODBASE:
P0A9F9
PDB:
5FO5
PFAM:
PF00126
PFAM:
PF03466
PRIDE:
P0A9F9
PRINTS:
PR00039
PRODB:
PRO_000023220
PROSITE:
PS50931
PROTEINMODELPORTAL:
P0A9F9
REFSEQ:
NP_418272
SMR:
P0A9F9
UNIPROT:
P0A9F9


Operon      
Name: metR         
Operon arrangement:
Transcription unit        Promoter
metR
metR


Transcriptional Regulation      
Display Regulation             
Activated by: OxyR
Repressed by: MetR, MetJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yigMp3 4011050 forward Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_4484 4012886 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4485 4012922 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4486 4012947 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4487 4013010 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4488 4013017 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4489 4013034 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4490 4013061 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4491 4013079 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4492 4013127 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4493 4013584 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4494 4013877 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4495 4013894 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4496 4013905 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4497 4013974 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4498 4014376 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4499 4014407 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4500 4014445 forward nd [RS-EPT-CBR] [5]
  promoter TSS_4501 4014468 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_4502 4015162 forward nd [RS-EPT-CBR] [5]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Daniels DL., Plunkett G., Burland V., Blattner FR., 1992, Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes., Science 257(5071):771-8

 [2] Maxon ME., Redfield B., Cai XY., Shoeman R., Fujita K., Fisher W., Stauffer G., Weissbach H., Brot N., 1989, Regulation of methionine synthesis in Escherichia coli: effect of the MetR protein on the expression of the metE and metR genes., Proc Natl Acad Sci U S A 86(1):85-9

 [3] Maxon ME., Wigboldus J., Brot N., Weissbach H., 1990, Structure-function studies on Escherichia coli MetR protein, a putative prokaryotic leucine zipper protein., Proc Natl Acad Sci U S A 87(18):7076-9

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB