RegulonDB RegulonDB 10.6.3: Gene Form
   

mglA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mglA mglC mglB mglAp mglAp mglCp6 mglCp6 mglCp9 mglCp9 mglCp5 mglCp5

Gene      
Name: mglA    Texpresso search in the literature
Synonym(s): ECK2142, EG10592, b2149, mgl, mglP
Genome position(nucleotides): 2237769 <-- 2239289 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.36
External database links:  
ASAP:
ABE-0007103
CGSC:
502
ECHOBASE:
EB0587
ECOCYC:
EG10592
ECOLIHUB:
mglA
OU-MICROARRAY:
b2149
REGULONDB:
b2149
STRING:
511145.b2149
M3D: mglA
COLOMBOS: mglA
PortEco: b2149


Product      
Name: D-galactose/methyl-galactoside ABC transporter ATP binding subunit
Synonym(s): Mgl, MglA, MglP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 56.415
Isoelectric point: 7.746
Motif(s):
 
Type Positions Sequence
14 -> 249 LEMSGINKSFPGVKALDNVNLKVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGTILFQGKEIDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGMFVDQDKMYRETKAIFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTSSLTEKEVNHLFTIIRKLKERGCGIVYISHKMEEIFQLCDEVTVLRDGQWIATEPLAGLTMDKIIAMMVGRS
29 -> 178 LDNVNLKVRPHSIHALMGENGAGKSTLLKCLFGIYQKDSGTILFQGKEIDFHSAKEALENGISMVHQELNLVLQRSVMDNMWLGRYPTKGMFVDQDKMYRETKAIFDELDIDIDPRARVGTLSVSQMQMIEIAKAFSYNAKIVIMDEPTS
46 -> 53 GENGAGKS
170 -> 177 IVIMDEPT
407 -> 410 LSGG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016787 - hydrolase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005354 - galactose transmembrane transporter activity
GO:0015407 - monosaccharide-transporting ATPase activity
GO:0043211 - carbohydrate-transporting ATPase activity
GO:0015592 - methylgalactoside transmembrane transporter activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0008643 - carbohydrate transport
GO:0015757 - galactose transmembrane transport
GO:0015765 - methylgalactoside transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MGLA-MONOMER
ECOLIWIKI:
b2149
INTERPRO:
IPR017871
INTERPRO:
IPR027417
INTERPRO:
IPR015862
INTERPRO:
IPR003593
INTERPRO:
IPR003439
MODBASE:
P0AAG8
PANTHER:
PTHR43790:SF7
PFAM:
PF00005
PRIDE:
P0AAG8
PRODB:
PRO_000023222
PROSITE:
PS51260
PROSITE:
PS00211
PROSITE:
PS50893
PROTEINMODELPORTAL:
P0AAG8
REFSEQ:
NP_416654
SMART:
SM00382
SMR:
P0AAG8
UNIPROT:
P0AAG8


Operon      
Name: mglBAC         
Operon arrangement:
Transcription unit        Promoter
mglAC
mglBAC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GalS, FlhDC, GalR, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mglCp5 2237858 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mglCp9 2237923 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mglCp6 2237959 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB