RegulonDB RegulonDB 10.6.3: Gene Form
   

mglC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mglA preA mglC preT mglCp6 mglCp6 mglCp9 mglCp9 mglCp5 mglCp5

Gene      
Name: mglC    Texpresso search in the literature
Synonym(s): ECK2141, EG10594, b2148, mglP
Genome position(nucleotides): 2236743 <-- 2237753 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.25
External database links:  
ASAP:
ABE-0007101
CGSC:
500
ECHOBASE:
EB0589
ECOCYC:
EG10594
ECOLIHUB:
mglC
OU-MICROARRAY:
b2148
REGULONDB:
b2148
STRING:
511145.b2148
M3D: mglC
COLOMBOS: mglC
PortEco: b2148


Product      
Name: D-galactose/methyl-galactoside ABC transporter membrane subunit
Synonym(s): MglC, MglP
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 35.55
Isoelectric point: 9.282
Motif(s):
 
Type Positions Sequence
306 -> 326 IGVNPYWQYIIKGAIIIFAVA
53 -> 73 IIIALGVAGLIVTQGTDLSAG
17 -> 37 GIYVVLLVLLAIIIFQDPTFL
41 -> 325 NLSNILTQSSVRIIIALGVAGLIVTQGTDLSAGRQVGLAAVVAATLLQSMDNANKVFPEMATMPIALVILIVCAIGAVIGLINGLIIAYLNVTPFITTLGTMIIVYGINSLYYDFVGASPISGFDSGFSTFAQGFVALGSFRLSYITFYALIAVAFVWVLWNKTRFGKNIFAIGGNPEAAKVSGVNVGLNLLMIYALSGVFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFSGGVGTVIGVVTGVIIFTVINYGLTYIGVNPYWQYIIKGAIIIFAV
107 -> 127 LVILIVCAIGAVIGLINGLII

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005354 - galactose transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
GO:0015592 - methylgalactoside transmembrane transporter activity
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0008643 - carbohydrate transport
GO:0015757 - galactose transmembrane transport
GO:0055085 - transmembrane transport
GO:0015765 - methylgalactoside transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MGLC-MONOMER
ECOLIWIKI:
b2148
INTERPRO:
IPR030158
INTERPRO:
IPR001851
PANTHER:
PTHR32196:SF18
PFAM:
PF02653
PRIDE:
P23200
PRODB:
PRO_000023224
PROTEINMODELPORTAL:
P23200
REFSEQ:
NP_416653
UNIPROT:
P23200


Operon      
Name: mglBAC         
Operon arrangement:
Transcription unit        Promoter
mglAC
mglBAC


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: GalS, FlhDC, Fis, GalR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mglCp5 2237858 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mglCp9 2237923 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter mglCp6 2237959 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB