RegulonDB RegulonDB 10.8: Gene Form
   

minC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

minD minC ycgJ terminator TSS_1508 TSS_1508 ycgJp5 ycgJp5 TSS_1507 TSS_1507 TSS_1506 TSS_1506 TSS_1505 TSS_1505 TSS_1504 TSS_1504 TSS_1503 TSS_1503 TSS_1502 TSS_1502 minEp3 minEp3

Gene      
Name: minC    Texpresso search in the literature
Synonym(s): ECK1164, EG10596, b1176, minB
Genome position(nucleotides): 1225385 <-- 1226080 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.01
External database links:  
ASAP:
ABE-0003941
CGSC:
31329
ECHOBASE:
EB0591
OU-MICROARRAY:
b1176
PortEco:
minC
STRING:
511145.b1176
COLOMBOS: minC


Product      
Name: Z-ring positioning protein MinC
Synonym(s): MinB, MinC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 24.775
Isoelectric point: 6.883
Motif(s):
 
Type Positions Sequence
172 -> 172 R
10 -> 10 G
100 -> 124 EGKEKAPRPAPTPQAPAQNTTPVTK
1 -> 103 MSNTPIELKGSSFTLSVVHLHEAEPKVIHQALEDKIAQAPAFLKHAPVVLNVSALEDPVNWSAMHKAVSATGLRVIGVSGCKDAQLKAEIEKMGLPILTEGKE
125 -> 231 TRLIDTPVRSGQRIYAPQCDLIVTSHVSAGAELIADGNIHVYGMMRGRALAGASGDRETQIFCTNLMAELVSIAGEYWLSDQIPAEFYGKAARLQLVENALTVQPLN

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
  5 - cell processes --> 5.2 - cell cycle physiology
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0060187 - cell pole
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0000902 - cell morphogenesis
GO:0051301 - cell division
GO:0007049 - cell cycle
GO:0051302 - regulation of cell division
GO:0051726 - regulation of cell cycle
GO:0000917 - division septum assembly
GO:0032955 - regulation of division septum assembly
GO:0090529 - cell septum assembly
GO:1901891 - regulation of cell septum assembly
External database links:  
DIP:
DIP-10214N
ECOCYC:
EG10596-MONOMER
ECOLIWIKI:
b1176
INTERPRO:
IPR005526
INTERPRO:
IPR038061
INTERPRO:
IPR036145
INTERPRO:
IPR016098
INTERPRO:
IPR013033
INTERPRO:
IPR007874
MINT:
P18196
MODBASE:
P18196
PANTHER:
PTHR34108
PFAM:
PF05209
PFAM:
PF03775
PRIDE:
P18196
PRODB:
PRO_000023237
REFSEQ:
NP_415694
SMR:
P18196
UNIPROT:
P18196


Operon      
Name: minCDE         
Operon arrangement:
Transcription unit        Promoter
minCDE


RNA cis-regulatory element    
Attenuation: Translational


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter minEp3 1224711 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1502 1224778 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1503 1225451 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1504 1225647 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1505 1226139 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1506 1226141 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1507 1226164 forward nd [RS-EPT-CBR] [2]
  promoter ycgJp5 1226478 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1508 1226481 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB