RegulonDB RegulonDB 10.7: Gene Form
   

motB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cheA motB motA flhC CpxR anti-anti-terminator anti-terminator terminator motAp motAp TSS_2231 TSS_2231 TSS_2230 TSS_2230 TSS_2229 TSS_2229 TSS_2228 TSS_2228 cheWp5 cheWp5

Gene      
Name: motB    Texpresso search in the literature
Synonym(s): ECK1890, EG10602, b1889, flaJ
Genome position(nucleotides): 1975329 <-- 1976255 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.18
External database links:  
ASAP:
ABE-0006297
CGSC:
490
ECHOBASE:
EB0597
OU-MICROARRAY:
b1889
PORTECO:
motB
REGULONDB:
b1889
STRING:
511145.b1889
M3D: motB
COLOMBOS: motB
PortEco: b1889


Product      
Name: motility protein B
Synonym(s): FlaJ, MotB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 34.186
Isoelectric point: 9.531
Motif(s):
 
Type Positions Sequence
164 -> 164 G
148 -> 268 LRIQIIDSQNRPMFRTGSADVEPYMRDILRAIAPVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVGMAATMRLSDRGPDDAVNRRISLLVLNKQ
160 -> 257 MFRTGSADVEPYMRDILRAIAPVLNGIPNRISLSGHTDDFPYASGEKGYSNWELSADRANASRRELMVGGLDSGKVLRVVGMAATMRLSDRGPDDAVN
205 -> 205 E
31 -> 31 A

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.A - alpha-type channels
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.1 - membrane
  6 - cell structure --> 6.4 - flagella
Gene Ontology Terms (GO)  
cellular_component GO:0120101 - bacterial-type flagellum stator complex
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
biological_process GO:0006935 - chemotaxis
GO:0097588 - archaeal or bacterial-type flagellum-dependent cell motility
Note(s): Note(s): ...[more].
Reference(s): [1] Ishida T., et al., 2019
[2] Minamino T., et al., 2018
External database links:  
DIP:
DIP-47996N
ECOCYC:
MOTB-FLAGELLAR-MOTOR-STATOR-PROTEIN
ECOLIWIKI:
b1889
INTERPRO:
IPR025713
INTERPRO:
IPR006665
INTERPRO:
IPR036737
MODBASE:
P0AF06
PFAM:
PF13677
PFAM:
PF00691
PRIDE:
P0AF06
PRODB:
PRO_000023275
PROSITE:
PS51123
PROTEINMODELPORTAL:
P0AF06
REFSEQ:
NP_416403
SMR:
P0AF06
UNIPROT:
P0AF06


Operon      
Name: motAB-cheAW         
Operon arrangement:
Transcription unit        Promoter
motAB-cheAW


Transcriptional Regulation      
Display Regulation             
Repressed by: CpxR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cheWp5 1973462 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2228 1973726 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2229 1975808 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2230 1976720 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2231 1977300 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ishida T., Ito R., Clark J., Matzke NJ., Sowa Y., Baker MAB., 2019, Sodium-powered stators of the bacterial flagellar motor can generate torque in the presence of phenamil with mutations near the peptidoglycan-binding region., Mol Microbiol

 [2] Minamino T., Terahara N., Kojima S., Namba K., 2018, Autonomous control mechanism of stator assembly in the bacterial flagellar motor in response to changes in the environment., Mol Microbiol 109(6):723-734

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB