RegulonDB RegulonDB 10.6.3: Gene Form
   

mreC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mreC mreB yhdE mreD rng TSS_3582 TSS_3582 TSS_3581 TSS_3581 TSS_3580 TSS_3580 TSS_3579 TSS_3579 mreDp2 mreDp2

Gene      
Name: mreC    Texpresso search in the literature
Synonym(s): ECK3238, EG10609, b3250
Genome position(nucleotides): 3398875 <-- 3399978 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.98
External database links:  
ASAP:
ABE-0010658
CGSC:
31348
ECHOBASE:
EB0604
ECOCYC:
EG10609
ECOLIHUB:
mreC
OU-MICROARRAY:
b3250
REGULONDB:
b3250
STRING:
511145.b3250
M3D: mreC
COLOMBOS: mreC
PortEco: b3250


Product      
Name: cell shape determining protein MreC
Synonym(s): MreC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space,cytosol,inner membrane
Molecular weight: 39.53
Isoelectric point: 8.639
Motif(s):
 
Type Positions Sequence
57 -> 110 RELLDGVSQTLASRDQLELENRALRQELLLKNSELLMLGQYKQENARLRELLGS
13 -> 35 IRLILAVLVALGIIIADSRLGTF
279 -> 367 PMTPEEVHRVANERLMQMMPQVLPSPDAMGPKLPEPATGIAQPTPQQPATGNAATAPAAPTQPAANRSPQRATPPQSGAQPPARAPGGQ
1 -> 12 MKPIFSRGPSLQ
111 -> 367 PLRQDEQKMVTQVISTVNDPYSDQVVIDKGSVNGVYEGQPVISDKGVVGQVVAVAKLTSRVLLICDATHALPIQVLRNDIRVIAAGNGCTDDLQLEHLPANTDIRVGDVLVTSGLGGRFPEGYPVAVVSSVKLDTQRAYTVIQARPTAGLQRLRYLLLLWGADRNGANPMTPEEVHRVANERLMQMMPQVLPSPDAMGPKLPEPATGIAQPTPQQPATGNAATAPAAPTQPAANRSPQRATPPQSGAQPPARAPGGQ

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents)
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0043621 - protein self-association
biological_process GO:0008360 - regulation of cell shape
GO:0071963 - establishment or maintenance of cell polarity regulating cell shape
Note(s): Note(s): ...[more].
Evidence: [IGI] Inferred from genetic interaction
[IMP] Inferred from mutant phenotype
Reference(s): [1] Bendezu FO., et al., 2008
[2] Kruse T., et al., 2005
[3] Wachi M., et al., 1989
[4] van den Ent F., et al., 2010
[5] van den Ent F., et al., 2006
External database links:  
DIP:
DIP-10256N
ECOCYC:
EG10609-MONOMER
ECOLIWIKI:
b3250
INTERPRO:
IPR007221
MINT:
P16926
PANTHER:
PTHR34138
PFAM:
PF04085
PRIDE:
P16926
PRODB:
PRO_000023290
PROTEINMODELPORTAL:
P16926
REFSEQ:
NP_417716
SMR:
P16926
UNIPROT:
P16926


Operon      
Name: mreBCD         
Operon arrangement:
Transcription unit        Promoter
mreB
mreBCD
mreB
mreBCD
mreB
mreBCD
mreCD


Transcriptional Regulation      
Display Regulation             
Repressed by: BolA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter mreDp2 3399083 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_3579 3399805 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3580 3400666 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3581 3400674 reverse nd [RS-EPT-CBR] [7]
  promoter TSS_3582 3401076 reverse nd [RS-EPT-CBR] [7]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bendezu FO., de Boer PA., 2008, Conditional lethality, division defects, membrane involution, and endocytosis in mre and mrd shape mutants of Escherichia coli., J Bacteriol 190(5):1792-811

 [2] Kruse T., Bork-Jensen J., Gerdes K., 2005, The morphogenetic MreBCD proteins of Escherichia coli form an essential membrane-bound complex., Mol Microbiol 55(1):78-89

 [3] Wachi M., Doi M., Okada Y., Matsuhashi M., 1989, New mre genes mreC and mreD, responsible for formation of the rod shape of Escherichia coli cells., J Bacteriol 171(12):6511-6

 [4] van den Ent F., Johnson CM., Persons L., de Boer P., Lowe J., 2010, Bacterial actin MreB assembles in complex with cell shape protein RodZ., EMBO J 29(6):1081-90

 [5] van den Ent F., Leaver M., Bendezu F., Errington J., de Boer P., Lowe J., 2006, Dimeric structure of the cell shape protein MreC and its functional implications., Mol Microbiol 62(6):1631-42

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB