RegulonDB RegulonDB 10.8: Gene Form
   

msbA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ycaI msbA ycaQ lpxK TSS_1189 TSS_1189

Gene      
Name: msbA    Texpresso search in the literature
Synonym(s): ECK0905, EG10613, b0914
Genome position(nucleotides): 966621 --> 968369 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.89
External database links:  
ASAP:
ABE-0003113
CGSC:
31743
ECHOBASE:
EB0608
MIM:
612244
OU-MICROARRAY:
b0914
PortEco:
msbA
STRING:
511145.b0914
COLOMBOS: msbA


Product      
Name: ATP-binding lipopolysaccharide transport protein
Synonym(s): MsbA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 64.461
Isoelectric point: 8.873
Motif(s):
 
Type Positions Sequence
270 -> 270 A
501 -> 519 ILILDEATSALDTESERAI
27 -> 310 LIVAGVALILNAASDTFMLSLLKPLLDDGFGKTDRSVLVWMPLVVIGLMILRGITSYVSSYCISWVSGKVVMTMRRRLFGHMMGMPVSFFDKQSTGTLLSRITYDSEQVASSSSGALITVVREGASIIGLFIMMFYYSWQLSIILIVLAPIVSIAIRVVSKRFRNISKNMQNTMGQVTTSAEQMLKGHKEVLIFGGQEVETKRFDKVSNRMRLQGMKMVSASSISDPIIQLIASLALAFVLYAASFPSVMDSLTAGTITVVFSSMIALMRPLKSLTNVNAQFQR
63 -> 83 VLVWMPLVVIGLMILRGITSY
481 -> 484 LSGG

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0016887 - ATPase activity
GO:0042626 - ATPase-coupled transmembrane transporter activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015437 - lipopolysaccharide floppase activity
GO:0008289 - lipid binding
GO:0008144 - drug binding
GO:0008559 - ATPase-coupled xenobiotic transmembrane transporter activity
GO:0042802 - identical protein binding
GO:0034040 - ATPase-coupled lipid transmembrane transporter activity
biological_process GO:0015920 - lipopolysaccharide transport
GO:0006869 - lipid transport
GO:0055085 - transmembrane transport
GO:0034204 - lipid translocation
Note(s): Note(s): ...[more].
Reference(s): [1] Campbell JD., et al., 2003
[2] Chang G., et al., 2006
[3] Davidson AL., et al., 2005
[4] Doerrler WT. 2007
[5] Eckford PD., et al., 2010
[6] Fujishima H., et al., 2002
[7] Haubertin DY., et al., 2006
[8] Higgins CF., et al., 2001
[9] Miller G. 2006
[10] Mittal A., et al., 2012
[11] Reyes CL., et al., 2005
[12] Reyes CL., et al., 2005
[13] Schmitt L. 2002
[14] Schultz KM., et al., 2011
[15] Shilling RA., et al., 2003
[16] Siarheyeva A., et al., 2009
[17] Thomas PJ., et al., 2001
[18] Wang X., et al., 2004
[19] Ward A., et al., 2007
[20] Woebking B., et al., 2008
[21] Zgurskaya HI. 2002
External database links:  
DIP:
DIP-36229N
DISPROT:
DP00400
ECOCYC:
EG10613-MONOMER
ECOLIWIKI:
b0914
INTERPRO:
IPR003439
INTERPRO:
IPR039421
INTERPRO:
IPR036640
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR011917
INTERPRO:
IPR003593
INTERPRO:
IPR011527
MINT:
MINT-1277336
MODBASE:
P60752
PANTHER:
PTHR24221
PDB:
3B5W
PFAM:
PF00664
PFAM:
PF00005
PRIDE:
P60752
PRODB:
PRO_000023294
PROSITE:
PS50893
PROSITE:
PS51239
PROSITE:
PS50929
PROSITE:
PS00211
REFSEQ:
NP_415434
SMART:
SM00382
SMR:
P60752
UNIPROT:
P60752


Operon      
Name: ycaI-msbA-lpxK-ycaQ         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1189 966594 forward nd [RS-EPT-CBR] [22]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Campbell JD., Biggin PC., Baaden M., Sansom MS., 2003, Extending the structure of an ABC transporter to atomic resolution: modeling and simulation studies of MsbA., Biochemistry 42(13):3666-73

 [2] Chang G., Roth CB., Reyes CL., Pornillos O., Chen YJ., Chen AP., 2006, Retraction., Science 314(5807):1875

 [3] Davidson AL., Chen J., 2005, Structural biology. Flipping lipids: is the third time the charm?, Science 308(5724):963-5

 [4] Doerrler WT., 2007, Density gradient enrichment of Escherichia coli conditional msbA mutants., Appl Environ Microbiol 73(24):7992-6

 [5] Eckford PD., Sharom FJ., 2010, The reconstituted Escherichia coli MsbA protein displays lipid flippase activity., Biochem J 429(1):195-203

 [6] Fujishima H., Nishimura A., Wachi M., Takagi H., Hirasawa T., Teraoka H., Nishimori K., Kawabata T., Nishikawa K., Nagai K., 2002, kdsA mutations affect FtsZ-ring formation in Escherichia coli K-12., Microbiology 148(Pt 1):103-12

 [7] Haubertin DY., Madaoui H., Sanson A., Guerois R., Orlowski S., 2006, Molecular dynamics simulations of E. coli MsbA transmembrane domain: formation of a semipore structure., Biophys J 91(7):2517-31

 [8] Higgins CF., Linton KJ., 2001, Structural biology. The xyz of ABC transporters., Science 293(5536):1782-4

 [9] Miller G., 2006, Scientific publishing. A scientist's nightmare: software problem leads to five retractions., Science 314(5807):1856-7

 [10] Mittal A., Bohm S., Grutter MG., Bordignon E., Seeger MA., 2012, Asymmetry in the homodimeric ABC transporter MsbA recognized by a DARPin., J Biol Chem 287(24):20395-406

 [11] Reyes CL., Chang G., 2005, Structure of the ABC transporter MsbA in complex with ADP.vanadate and lipopolysaccharide., Science 308(5724):1028-31

 [12] Reyes CL., Chang G., 2005, Lipopolysaccharide stabilizes the crystal packing of the ABC transporter MsbA., Acta Crystallograph Sect F Struct Biol Cryst Commun 61(Pt 7):655-8

 [13] Schmitt L., 2002, The first view of an ABC transporter: the X-ray crystal structure of MsbA from E. coli., Chembiochem 3(2-3):161-5

 [14] Schultz KM., Merten JA., Klug CS., 2011, Characterization of the E506Q and H537A Dysfunctional Mutants in the E. coli ABC Transporter MsbA., Biochemistry 50(18):3599-608

 [15] Shilling RA., Balakrishnan L., Shahi S., Venter H., van Veen HW., 2003, A new dimer interface for an ABC transporter., Int J Antimicrob Agents 22(3):200-4

 [16] Siarheyeva A., Sharom FJ., 2009, The ABC transporter MsbA interacts with lipid A and amphipathic drugs at different sites., Biochem J 419(2):317-28

 [17] Thomas PJ., Hunt JF., 2001, A snapshot of Nature's favorite pump., Nat Struct Biol 8(11):920-3

 [18] Wang X., Karbarz MJ., McGrath SC., Cotter RJ., Raetz CR., 2004, MsbA transporter-dependent lipid A 1-dephosphorylation on the periplasmic surface of the inner membrane: topography of francisella novicida LpxE expressed in Escherichia coli., J Biol Chem 279(47):49470-8

 [19] Ward A., Reyes CL., Yu J., Roth CB., Chang G., 2007, Flexibility in the ABC transporter MsbA: Alternating access with a twist., Proc Natl Acad Sci U S A 104(48):19005-10

 [20] Woebking B., Velamakanni S., Federici L., Seeger MA., Murakami S., van Veen HW., 2008, Functional role of transmembrane helix 6 in drug binding and transport by the ABC transporter MsbA., Biochemistry 47(41):10904-14

 [21] Zgurskaya HI., 2002, Molecular analysis of efflux pump-based antibiotic resistance., Int J Med Microbiol 292(2):95-105

 [22] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB