RegulonDB RegulonDB 10.6.3: Gene Form
   

mukB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mukB ldtD mukF mukE cmoM CpxR ldtDp ldtDp TSS_1197 TSS_1197 TSS_1196 TSS_1196 TSS_1195 TSS_1195 TSS_1194 TSS_1194

Gene      
Name: mukB    Texpresso search in the literature
Synonym(s): ECK0915, EG10618, b0924
Genome position(nucleotides): 976326 --> 980786 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.66
External database links:  
ASAP:
ABE-0003138
CGSC:
31516
ECHOBASE:
EB0613
ECOCYC:
EG10618
ECOLIHUB:
mukB
OU-MICROARRAY:
b0924
REGULONDB:
b0924
STRING:
511145.b0924
M3D: mukB
COLOMBOS: mukB
PortEco: b0924


Product      
Name: chromosome partitioning protein MukB
Synonym(s): MukB, cell division protein involved in chromosome partitioning
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,bacterial nucleoid
Molecular weight: 170.229
Isoelectric point: 5.003
Motif(s):
 
Type Positions Sequence
2 -> 227 IERGKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAAFVTALIPDLTLLHFRNTTEAGATSGSRDKGLHGKLKAGVCYSMLDTINSRHQRVVVGVRLQQVAGRDRKVDIKPFAIQGLPMSVQPTQLVTETLNERQARVLPLNELKDKLEAMEGVQFKQFNSITDYHSLMFDLGIIARRLRSASDRSKFYRLIEASLYGGISSAITRSLRDYLLPENSG
266 -> 266 A
645 -> 810 ERDEVGARKNAVDEEIERLSQPGGSEDQRLNALAERFGGVLLSEIYDDVSLEDAPYFSALYGPSRHAIVVPDLSQVTEHLEGLTDCPEDLYLIEGDPQSFDDSVFSVDELEKAVVVKIADRQWRYSRFPEVPLFGRAARESRIESLHAEREVLSERFATLSFDVQK
1174 -> 1175 SE
1201 -> 1201 D

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.1 - cell division
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009295 - nucleoid
GO:0000796 - condensin complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0005525 - GTP binding
GO:0042802 - identical protein binding
biological_process GO:0051301 - cell division
GO:0006260 - DNA replication
GO:0007049 - cell cycle
GO:0007059 - chromosome segregation
GO:0030261 - chromosome condensation
GO:0007062 - sister chromatid cohesion
Note(s): Note(s): ...[more].
Reference(s): [1] Vos SM., et al., 2013
External database links:  
DIP:
DIP-10273N
ECOCYC:
EG10618-MONOMER
ECOLIWIKI:
b0924
INTERPRO:
IPR032520
INTERPRO:
IPR027417
INTERPRO:
IPR012090
INTERPRO:
IPR007406
MINT:
P22523
MODBASE:
P22523
PDB:
3IBP
PDB:
4MN4
PDB:
1QHL
PDB:
2WMM
PFAM:
PF04310
PFAM:
PF16330
PRIDE:
P22523
PRODB:
PRO_000023309
PROTEINMODELPORTAL:
P22523
REFSEQ:
NP_415444
SMR:
P22523
UNIPROT:
P22523


Operon      
Name: cmoM-mukFEB         
Operon arrangement:
Transcription unit        Promoter
smtA-mukFEB


Transcriptional Regulation      
Display Regulation             
Activated by: H-NS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1194 975868 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1195 979917 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1196 980088 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1197 980108 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Vos SM., Stewart NK., Oakley MG., Berger JM., 2013, Structural basis for the MukB-topoisomerase IV interaction and its functional implications in vivo., EMBO J 32(22):2950-62

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB