RegulonDB RegulonDB 10.8: Gene Form
   

mutS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mutS pphB ygbA NsrR NsrR NsrR terminator terminator pphBp1 pphBp1 mutSp mutSp ygbAp ygbAp

Gene      
Name: mutS    Texpresso search in the literature
Synonym(s): ECK2728, EG10625, ant, b2733, fdv, plm
Genome position(nucleotides): 2857093 --> 2859654 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.13
External database links:  
ASAP:
ABE-0008977
CGSC:
469
ECHOBASE:
EB0620
MIM:
608089
MIM:
617100
OU-MICROARRAY:
b2733
PortEco:
mutS
STRING:
511145.b2733
COLOMBOS: mutS


Product      
Name: DNA mismatch repair protein MutS
Synonym(s): Ant, Fdv, MutS, Plm
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 95.247
Isoelectric point: 5.232
Motif(s):
 
Type Positions Sequence
116 -> 266 PGTISDEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCLLQYAKDTQRTTLPHIRSITMEREQDS
610 -> 797 LIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAGVPKEVIKRARQKLRELE
131 -> 256 NLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAELLYAEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCLLQYAKDTQRTTLPHIR
568 -> 765 TCPTFIDKPGIRITEGRHPVVEQVLNEPFIANPLNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAADDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIKALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDG
766 -> 800 AASKSYGLAVAALAGVPKEVIKRARQKLRELESIS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032300 - mismatch repair complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0008094 - DNA-dependent ATPase activity
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003684 - damaged DNA binding
GO:0030983 - mismatched DNA binding
GO:0042802 - identical protein binding
GO:0043531 - ADP binding
GO:0032136 - adenine/cytosine mispair binding
GO:0008301 - DNA binding, bending
biological_process GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0006298 - mismatch repair
GO:0000018 - regulation of DNA recombination
Note(s): Note(s): ...[more].
Reference(s): [1] Cronan GE., et al., 2019
[2] Mukherjee S., et al., 2009
[3] Natrajan G., et al., 2003
External database links:  
DIP:
DIP-10287N
ECOCYC:
EG10625-MONOMER
ECOLIWIKI:
b2733
INTERPRO:
IPR007696
INTERPRO:
IPR007695
INTERPRO:
IPR005748
INTERPRO:
IPR000432
INTERPRO:
IPR027417
INTERPRO:
IPR036678
INTERPRO:
IPR007860
INTERPRO:
IPR007861
INTERPRO:
IPR017261
INTERPRO:
IPR016151
INTERPRO:
IPR036187
MINT:
P23909
MODBASE:
P23909
PANTHER:
PTHR11361:SF34
PDB:
6I5F
PDB:
5AKD
PDB:
5AKC
PDB:
5AKB
PDB:
3K0S
PDB:
2WTU
PDB:
2OK2
PDB:
1WBD
PDB:
1WBB
PDB:
1WB9
PDB:
1W7A
PDB:
1OH8
PDB:
1OH7
PDB:
1OH6
PDB:
1OH5
PDB:
1NG9
PDB:
1E3M
PDB:
3ZLJ
PFAM:
PF01624
PFAM:
PF05192
PFAM:
PF05188
PFAM:
PF00488
PFAM:
PF05190
PRIDE:
P23909
PRODB:
PRO_000023326
PROSITE:
PS00486
REFSEQ:
NP_417213
SMART:
SM00534
SMART:
SM00533
SMR:
P23909
UNIPROT:
P23909


Operon      
Name: mutS         
Operon arrangement:
Transcription unit        Promoter
mutS


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter pphBp1 2859737 forward Similarity to the consensus
Read more >
[ICWHO] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Cronan GE., Kouzminova EA., Kuzminov A., 2019, Near-continuously synthesized leading strands in Escherichia coli are broken by ribonucleotide excision., Proc Natl Acad Sci U S A 116(4):1251-1260

 [2] Mukherjee S., Law SM., Feig M., 2009, Deciphering the mismatch recognition cycle in MutS and MSH2-MSH6 using normal-mode analysis., Biophys J 96(5):1707-20

 [3] Natrajan G., Lamers MH., Enzlin JH., Winterwerp HH., Perrakis A., Sixma TK., 2003, Structures of Escherichia coli DNA mismatch repair enzyme MutS in complex with different mismatches: a common recognition mode for diverse substrates., Nucleic Acids Res 31(16):4814-21

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB