RegulonDB RegulonDB 10.8: Gene Form
   

nadB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nadB srmB yfiC rseD rpoE IHF GlrR NadR GlrR RcsB NtrC GlrR CRP CpxR DksA DksA-ppGpp DksA-ppGpp ppGpp terminator TSS_2874 (cluster) TSS_2874 (cluster) srmBp4 srmBp4 yfiCp3 yfiCp3 rpoEp1b rpoEp1b TSS_2873 TSS_2873 nadBp nadBp rpoEp2b rpoEp2b rpoEp4 rpoEp4 rpoEp1a rpoEp1a rpoEp5 rpoEp5 rpoEp2a rpoEp2a

Gene      
Name: nadB    Texpresso search in the literature
Synonym(s): ECK2572, EG10631, b2574, nic, nicB
Genome position(nucleotides): 2710420 --> 2712042 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.17
External database links:  
ASAP:
ABE-0008471
CGSC:
466
ECHOBASE:
EB0625
OU-MICROARRAY:
b2574
PortEco:
nadB
STRING:
511145.b2574
COLOMBOS: nadB


Product      
Name: L-aspartate oxidase
Synonym(s): NadB, Nic, NicB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 60.337
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
12 -> 26 LIIGSGAAGLSLALR
441 -> 521 HELRLFMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAHFRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPE
10 -> 392 DVLIIGSGAAGLSLALRLADQHQVIVLSKGPVTEGSTFYAQGGIAAVFDETDSIDSHVEDTLIAGAGICDRHAVEFVASNARSCVQWLIDQGVLFDTHIQPNGEESYHLTREGGHSHRRILHAADATGREVETTLVSKALNHPNIRVLERSNAVDLIVSDKIGLPGTRRVVGAWVWNRNKETVETCHAKAVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEFNQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGTRFMPDFDERGELAPRDIVARAIDHEMKRLGADCMFLDISHKPADFIRQHFPMIYEKLLGLGIDLTQEPVPIVPAAHYTCGGVMVDDHGRTDVEGLYAIGEVSYTGLHGANRMASNSL
160 -> 160 S
485 -> 485 N

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0008734 - L-aspartate oxidase activity
GO:0044318 - L-aspartate:fumarate oxidoreductase activity
biological_process GO:0009435 - NAD biosynthetic process
GO:0019363 - pyridine nucleotide biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0034628 - 'de novo' NAD biosynthetic process from aspartate
Note(s): Note(s): ...[more].
Reference(s): [1] Chow C., et al., 2017
External database links:  
DIP:
DIP-556N
ECOCYC:
L-ASPARTATE-OXID-MONOMER
ECOLIWIKI:
b2574
INTERPRO:
IPR005288
INTERPRO:
IPR037099
INTERPRO:
IPR036188
INTERPRO:
IPR027477
INTERPRO:
IPR015939
INTERPRO:
IPR003953
MODBASE:
P10902
PANTHER:
PTHR42716:SF2
PDB:
1CHU
PDB:
1KNR
PDB:
1KNP
PFAM:
PF00890
PFAM:
PF02910
PRIDE:
P10902
PRINTS:
PR00368
PRODB:
PRO_000023333
REFSEQ:
NP_417069
SMR:
P10902
UNIPROT:
P10902


Operon      
Name: nadB         
Operon arrangement:
Transcription unit        Promoter
nadB


Transcriptional Regulation      
Display Regulation             
Repressed by: NadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2873 2710392 forward nd [RS-EPT-CBR] [2]
  promoter yfiCp3 2712805 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter srmBp4 2712876 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_2874 (cluster) 2712878 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Chow C., Hegde S., Blanchard JS., 2017, Mechanistic Characterization of Escherichia coli l-Aspartate Oxidase from Kinetic Isotope Effects., Biochemistry 56(31):4044-4052

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB