RegulonDB RegulonDB 10.8: Gene Form
   

nagB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nagE nagA nagB CRP NagC CRP NagC PhoP terminator nagEp nagEp TSS_806 TSS_806 TSS_805 (cluster) TSS_805 (cluster) nagBp nagBp TSS_804 TSS_804 TSS_803 (cluster) TSS_803 (cluster) TSS_802 TSS_802 nagAp nagAp TSS_801 TSS_801 nagCp2 nagCp2 nagCp1 nagCp1 TSS_799 TSS_799 TSS_798 TSS_798

Gene      
Name: nagB    Texpresso search in the literature
Synonym(s): ECK0666, EG10633, b0678, glmD
Genome position(nucleotides): 702811 <-- 703611 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.81
External database links:  
ASAP:
ABE-0002304
CGSC:
463
ECHOBASE:
EB0627
OU-MICROARRAY:
b0678
PortEco:
nagB
STRING:
511145.b0678
COLOMBOS: nagB


Product      
Name: glucosamine-6-phosphate deaminase
Synonym(s): GlmD, NagB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.774
Isoelectric point: 6.912
Motif(s):
 
Type Positions Sequence
148 -> 148 E
9 -> 224 AEQVGKWAARHIVNRINAFKPTADRPFVLGLPTGGTPMTTYKALVEMHKAGQVSFKHVVTFNMDEYVGLPKEHPESYYSFMHRNFFDHVDIPAENINLLNGNAPDIDAECRQYEEKIRSYGKIHLFMGGVGNDGHIAFNEPASSLASRTRIKTLTHDTRVANSRFFDNDVNQVPKYALTVGVGTLLDAEEVMILVLGSQKALALQAAVEGCVNHMW
143 -> 143 H
174 -> 174 F
239 -> 239 C

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.12 - amino sugar conversions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0004342 - glucosamine-6-phosphate deaminase activity
GO:0042802 - identical protein binding
biological_process GO:0006043 - glucosamine catabolic process
GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0006044 - N-acetylglucosamine metabolic process
GO:0006046 - N-acetylglucosamine catabolic process
GO:0006048 - UDP-N-acetylglucosamine biosynthetic process
GO:0019262 - N-acetylneuraminate catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Afroz T., et al., 2014
[2] Baran R., et al., 2013
[3] Rodionova IA., et al., 2018
External database links:  
DIP:
DIP-35992N
ECOCYC:
GLUCOSAMINE-6-P-DEAMIN-MONOMER
ECOLIWIKI:
b0678
INTERPRO:
IPR037171
INTERPRO:
IPR018321
INTERPRO:
IPR006148
INTERPRO:
IPR004547
MODBASE:
P0A759
PANTHER:
PTHR11280
PDB:
1FSF
PDB:
1HOR
PDB:
1HOT
PDB:
1JT9
PDB:
1CD5
PDB:
1FS6
PDB:
1FS5
PDB:
2WU1
PDB:
1FRZ
PDB:
1FQO
PDB:
1DEA
PFAM:
PF01182
PRIDE:
P0A759
PRODB:
PRO_000023337
PROSITE:
PS01161
REFSEQ:
NP_415204
SMR:
P0A759
UNIPROT:
P0A759


Operon      
Name: nagBAC-umpH         
Operon arrangement:
Transcription unit        Promoter
umpH
nagC
nagC
nagA
nagBACD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, NagC
Growth Conditions:

[1] 

C: Escherichia coli| MOPS| N-acetylglucosamine| exponential phase
E: Escherichia coli| MOPS| N-acetyl-D-mannosamine| exponential phase



Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_798 701606 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_799 701647 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_801 702710 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_802 703631 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_803 (cluster) 703638 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_804 703655 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_805 (cluster) 703711 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [4]
  promoter TSS_806 703828 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Afroz T., Biliouris K., Kaznessis Y., Beisel CL., 2014, Bacterial sugar utilization gives rise to distinct single-cell behaviours., Mol Microbiol 93(6):1093-103

 [2] Baran R., Bowen BP., Price MN., Arkin AP., Deutschbauer AM., Northen TR., 2013, Metabolic footprinting of mutant libraries to map metabolite utilization to genotype., ACS Chem Biol 8(1):189-99

 [3] Rodionova IA., Goodacre N., Babu M., Emili A., Uetz P., Saier MH., 2018, The Nitrogen Regulatory PII Protein (GlnB) and N -Acetylglucosamine 6-Phosphate Epimerase (NanE) Allosterically Activate Glucosamine 6-Phosphate Deaminase (NagB) in Escherichia coli., J Bacteriol 200(5)

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB