RegulonDB RegulonDB 10.8: Gene Form
   

nagC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

nagC nagA umpH TSS_801 TSS_801 nagCp2 nagCp2 nagCp1 nagCp1 TSS_799 TSS_799 TSS_798 TSS_798 TSS_797 TSS_797 TSS_796 TSS_796 TSS_795 TSS_795 TSS_794 TSS_794 TSS_793 TSS_793 TSS_792 TSS_792 umpHp umpHp

Gene      
Name: nagC    Texpresso search in the literature
Synonym(s): ECK0664, EG10636, b0676, nagR
Genome position(nucleotides): 700374 <-- 701594 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.99
External database links:  
ASAP:
ABE-0002299
CGSC:
31479
ECHOBASE:
EB0630
OU-MICROARRAY:
b0676
PortEco:
nagC
STRING:
511145.b0676
COLOMBOS: nagC


Product      
Name: DNA-binding transcriptional dual regulator NagC
Synonym(s): NagC, NagR, transcriptional repressor of nag (N-acetylglucosamine) operon
Sequence: Get amino acid sequence Fasta Format
Regulator Family: MarR
Cellular location: cytosol
Molecular weight: 44.541
Isoelectric point: 7.38
Motif(s):
 
Type Positions Sequence
203 -> 204 EH
25 -> 63 RLIDQYGPISRIQIAEQSQLAPASVTKITRQLIERGLIK
35 -> 44 RIQIAEQSQL
89 -> 392 IGVRLGRHDATITLFDLSSKVLAEEHYPLPERTQQTLEHALLNAIAQFIDSYQRKLRELIAISVILPGLVDPDSGKIHYMPHIQVENWGLVEALEERFKVTCFVGHDIRSLALAEHYFGASQDCEDSILVRVHRGTGAGIISNGRIFIGRNGNVGEIGHIQVEPLGERCHCGNFGCLETIAANAAIEQRVLNLLKQGYQSRVPLDDCTIKTICKAANKGDSLASEVIEYVGRHLGKTIAIAINLFNPQKIVIAGEITEADKVLLPAIESCINTQALKAFRTNLPVVRSELDHRSAIGAFALVKR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.12 - amino sugar conversions
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006355 - regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
Reference(s): [1] Condemine G., et al., 2005
[2] Peri KG., et al., 1990
[3] Plumbridge J. 2001
[4] Plumbridge J. 1995
[5] Plumbridge J., et al., 1991
[6] Plumbridge J., et al., 2004
[7] Plumbridge JA. 1991
[8] Plumbridge JA. 1989
[9] Sohanpal BK., et al., 2004
[10] Sohanpal BK., et al., 2007
External database links:  
DIP:
DIP-35984N
ECOCYC:
PD00266
ECOLIWIKI:
b0676
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR000835
INTERPRO:
IPR000600
MODBASE:
P0AF20
PANTHER:
PTHR18964
PFAM:
PF00480
PFAM:
PF01047
PRIDE:
P0AF20
PRODB:
PRO_000023338
PROSITE:
PS01125
REFSEQ:
NP_415202
SMR:
P0AF20
SWISSMODEL:
P0AF20
UNIPROT:
P0AF20


Operon      
Name: nagBAC-umpH         
Operon arrangement:
Transcription unit        Promoter
umpH
nagC
nagC
nagA
nagBACD


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_792 700355 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_793 701039 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_794 701340 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_795 701360 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_796 701362 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_797 701364 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_798 701606 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_799 701647 reverse nd [RS-EPT-CBR] [11]
  promoter TSS_801 702710 reverse nd [RS-EPT-CBR] [11]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Condemine G., Berrier C., Plumbridge J., Ghazi A., 2005, Function and expression of an N-acetylneuraminic acid-inducible outer membrane channel in Escherichia coli., J Bacteriol 187(6):1959-65

 [2] Peri KG., Goldie H., Waygood EB., 1990, Cloning and characterization of the N-acetylglucosamine operon of Escherichia coli., Biochem Cell Biol 68(1):123-37

 [3] Plumbridge J., 2001, DNA binding sites for the Mlc and NagC proteins: regulation of nagE, encoding the N-acetylglucosamine-specific transporter in Escherichia coli., Nucleic Acids Res 29(2):506-14

 [4] Plumbridge J., 1995, Co-ordinated regulation of amino sugar biosynthesis and degradation: the NagC repressor acts as both an activator and a repressor for the transcription of the glmUS operon and requires two separated NagC binding sites., EMBO J 14(16):3958-65

 [5] Plumbridge J., Kolb A., 1991, CAP and Nag repressor binding to the regulatory regions of the nagE-B and manX genes of Escherichia coli., J Mol Biol 217(4):661-79

 [6] Plumbridge J., Pellegrini O., 2004, Expression of the chitobiose operon of Escherichia coli is regulated by three transcription factors: NagC, ChbR and CAP., Mol Microbiol 52(2):437-49

 [7] Plumbridge JA., 1991, Repression and induction of the nag regulon of Escherichia coli K-12: the roles of nagC and nagA in maintenance of the uninduced state., Mol Microbiol 5(8):2053-62

 [8] Plumbridge JA., 1989, Sequence of the nagBACD operon in Escherichia coli K12 and pattern of transcription within the nag regulon., Mol Microbiol 3(4):505-15

 [9] Sohanpal BK., El-Labany S., Lahooti M., Plumbridge JA., Blomfield IC., 2004, Integrated regulatory responses of fimB to N-acetylneuraminic (sialic) acid and GlcNAc in Escherichia coli K-12., Proc Natl Acad Sci U S A 101(46):16322-7

 [10] Sohanpal BK., Friar S., Roobol J., Plumbridge JA., Blomfield IC., 2007, Multiple co-regulatory elements and IHF are necessary for the control of fimB expression in response to sialic acid and N-acetylglucosamine in Escherichia coli K-12., Mol Microbiol 63(4):1223-36

 [11] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB