RegulonDB RegulonDB 10.7: Gene Form
   

narL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ychO narX narL nc3

Gene      
Name: narL    Texpresso search in the literature
Synonym(s): ECK1215, EG10643, b1221, frdR, narR
Genome position(nucleotides): 1275179 <-- 1275829 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.77
External database links:  
ASAP:
ABE-0004097
CGSC:
18109
ECHOBASE:
EB0637
OU-MICROARRAY:
b1221
PORTECO:
narL
REGULONDB:
b1221
STRING:
511145.b1221
M3D: narL
COLOMBOS: narL
PortEco: b1221


Shine dalgarno      
Sequence: acagacgtccAAGGAGataccCAT


Product      
Name: DNA-binding transcriptional dual regulator NarL
Synonym(s): FrdR, NarL, NarR, nitrate/nitrite response regulator NarL
Sequence: Get amino acid sequence Fasta Format
Regulator Family: LuxR/UhpA
Cellular location: cytosol
Molecular weight: 23.927
Isoelectric point: 5.97
Motif(s):
 
Type Positions Sequence
9 -> 120 ILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKAL
149 -> 214 TERDVNQLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVWVHQER
155 -> 209 QLTPRERDILKLIAQGLPNKMIARRLDITESTVKVHVKHMLKKMKLKSRVEAAVW
8 -> 124 TILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESLDPDLILLDLNMPGMNGLETLDKLREKSLSGRIVVFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAA
115 -> 115 D

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001217 - DNA-binding transcription repressor activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
GO:0042128 - nitrate assimilation
Evidence: [AIFS] Automated inference of function from sequence
Reference(s): [1] Darwin AJ., et al., 1995
[2] Egan SM., et al., 1991
[3] Gunsalus RP., et al., 1989
[4] Nohno T., et al., 1989
[5] Pao GM., et al., 1995
[6] Parkinson JS. 1993
[7] Parkinson JS., et al., 1992
[8] Rabin RS., et al., 1993
[9] Stewart V., et al., 1989
[10] Stock JB., et al., 1990
[11] Tyson KL., et al., 1994
External database links:  
DIP:
DIP-35941N
ECOCYC:
NARL-MONOMER
ECOLIWIKI:
b1221
INTERPRO:
IPR000792
INTERPRO:
IPR016032
INTERPRO:
IPR036388
INTERPRO:
IPR011006
INTERPRO:
IPR001789
MODBASE:
P0AF28
PDB:
1ZG5
PDB:
1ZG1
PDB:
1RNL
PDB:
1JE8
PDB:
1A04
PFAM:
PF00196
PFAM:
PF00072
PRIDE:
P0AF28
PRINTS:
PR00038
PRODB:
PRO_000023356
PROSITE:
PS50110
PROSITE:
PS50043
PROSITE:
PS00622
PROTEINMODELPORTAL:
P0AF28
REFSEQ:
NP_415739
SMART:
SM00448
SMART:
SM00421
SMR:
P0AF28
SWISSMODEL:
P0AF28
UNIPROT:
P0AF28


Operon      
Name: narXL         
Operon arrangement:
Transcription unit        Promoter
narXL


Transcriptional Regulation      
Display Regulation             
Activated by: ModE
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Darwin AJ., Stewart V., 1995, Nitrate and nitrite regulation of the Fnr-dependent aeg-46.5 promoter of Escherichia coli K-12 is mediated by competition between homologous response regulators (NarL and NarP) for a common DNA-binding site., J Mol Biol 251(1):15-29

 [2] Egan SM., Stewart V., 1991, Mutational analysis of nitrate regulatory gene narL in Escherichia coli K-12., J Bacteriol 173(14):4424-32

 [3] Gunsalus RP., Kalman LV., Stewart RR., 1989, Nucleotide sequence of the narL gene that is involved in global regulation of nitrate controlled respiratory genes of Escherichia coli., Nucleic Acids Res 17(5):1965-75

 [4] Nohno T., Noji S., Taniguchi S., Saito T., 1989, The narX and narL genes encoding the nitrate-sensing regulators of Escherichia coli are homologous to a family of prokaryotic two-component regulatory genes., Nucleic Acids Res 17(8):2947-57

 [5] Pao GM., Saier MH., 1995, Response regulators of bacterial signal transduction systems: selective domain shuffling during evolution., J Mol Evol 40(2):136-54

 [6] Parkinson JS., 1993, Signal transduction schemes of bacteria., Cell 73(5):857-71

 [7] Parkinson JS., Kofoid EC., 1992, Communication modules in bacterial signaling proteins., Annu Rev Genet 26:71-112

 [8] Rabin RS., Stewart V., 1993, Dual response regulators (NarL and NarP) interact with dual sensors (NarX and NarQ) to control nitrate- and nitrite-regulated gene expression in Escherichia coli K-12., J Bacteriol 175(11):3259-68

 [9] Stewart V., Parales J., Merkel SM., 1989, Structure of genes narL and narX of the nar (nitrate reductase) locus in Escherichia coli K-12., J Bacteriol 171(4):2229-34

 [10] Stock JB., Stock AM., Mottonen JM., 1990, Signal transduction in bacteria., Nature 344(6265):395-400

 [11] Tyson KL., Cole JA., Busby SJ., 1994, Nitrite and nitrate regulation at the promoters of two Escherichia coli operons encoding nitrite reductase: identification of common target heptamers for both NarP- and NarL-dependent regulation., Mol Microbiol 13(6):1045-55


RegulonDB