RegulonDB RegulonDB 10.9: Gene Form
   

narV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

narY yddE narW narV narZ terminator narWp narWp TSS_1828 (cluster) TSS_1828 (cluster) yddEp5 yddEp5

Gene      
Name: narV    Texpresso search in the literature
Synonym(s): ECK1459, EG10644, b1465, chlZ
Genome position(nucleotides): 1535937 <-- 1536617 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.72
External database links:  
ASAP:
ABE-0004889
CGSC:
32136
ECHOBASE:
EB0638
ECOLIHUB:
narV
OU-MICROARRAY:
b1465
STRING:
511145.b1465
COLOMBOS: narV


Product      
Name: nitrate reductase Z subunit γ
Synonym(s): ChlZ, NarV
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 26.018
Isoelectric point: 10.101
Motif(s):
 
Type Positions Sequence
126 -> 149 PDIIIMSILLIQCLLGLSTIPFSA
5 -> 30 LNVFFYDIYPYICATVFFLGSWLRYD
49 -> 71 MVIWSNLFHIGILGIFFGHLFGM
184 -> 199 VFRLHLVLGMTIFLLF
84 -> 113 VAAKQLMAMVLGGICGVLTLIGGAGLLWRR

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0009325 - nitrate reductase complex
molecular_function GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0008940 - nitrate reductase activity
GO:0020037 - heme binding
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0042128 - nitrate assimilation
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NARV-MONOMER
ECOLIWIKI:
b1465
INTERPRO:
IPR036197
INTERPRO:
IPR023234
INTERPRO:
IPR003816
MODBASE:
P0AF32
PFAM:
PF02665
PRIDE:
P0AF32
PRODB:
PRO_000023360
REFSEQ:
NP_415982
SMR:
P0AF32
SWISSMODEL:
P0AF32
UNIPROT:
P0AF32


Operon      
Name: narZYWV         
Operon arrangement:
Transcription unit        Promoter
narWV
narZYWV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yddEp5 1535869 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1828 (cluster) 1535879 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB