RegulonDB RegulonDB 10.9: Gene Form
   

narW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

narZ narY yddE narW narV terminator narWp narWp TSS_1828 (cluster) TSS_1828 (cluster) yddEp5 yddEp5

Gene      
Name: narW    Texpresso search in the literature
Synonym(s): ECK1460, EG10645, b1466, chlZ
Genome position(nucleotides): 1536614 <-- 1537309 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.32
External database links:  
ASAP:
ABE-0004892
CGSC:
32139
ECHOBASE:
EB0639
ECOLIHUB:
narW
OU-MICROARRAY:
b1466
STRING:
511145.b1466
COLOMBOS: narW


Product      
Name: NarW, putative private chaperone for NarZ nitrate reductase subunit
Synonym(s): ChlZ, NarW
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.161
Isoelectric point: 4.202
Motif(s):
 
Type Positions Sequence
44 -> 151 LNAPLLDKQAEWCEVFDRGRTTSLLLFEHVHAESRDRGQAMVDLLAEYEKVGLQLDCRELPDYLPLYLEYLSVLPDDQAKEGLLNVAPILALLGGRLKQREAPWYALF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
molecular_function GO:0005515 - protein binding
GO:0051082 - unfolded protein binding
GO:0016530 - metallochaperone activity
biological_process GO:0051131 - chaperone-mediated protein complex assembly
GO:0042128 - nitrate assimilation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10321N
ECOCYC:
NARW-MONOMER
ECOLIWIKI:
b1466
INTERPRO:
IPR036411
INTERPRO:
IPR020945
INTERPRO:
IPR003765
MODBASE:
P19317
PANTHER:
PTHR43680
PFAM:
PF02613
PRIDE:
P19317
PRODB:
PRO_000023361
REFSEQ:
NP_415983
SMR:
P19317
UNIPROT:
P19317


Operon      
Name: narZYWV         
Operon arrangement:
Transcription unit        Promoter
narWV
narZYWV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yddEp5 1535869 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1828 (cluster) 1535879 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB