RegulonDB RegulonDB 10.8: Gene Form
   

narY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

narZ narY narU narW narV narZp narZp narWp narWp

Gene      
Name: narY    Texpresso search in the literature
Synonym(s): ECK1461, EG10647, b1467, chlZ
Genome position(nucleotides): 1537309 <-- 1538853 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.3
External database links:  
ASAP:
ABE-0004896
CGSC:
32142
ECHOBASE:
EB0641
OU-MICROARRAY:
b1467
PortEco:
narY
STRING:
511145.b1467
COLOMBOS: narY


Product      
Name: nitrate reductase Z subunit β
Synonym(s): ChlZ, NarY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,inner membrane
Molecular weight: 58.558
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
174 -> 205 TFMMYLPRLCEHCLNPSCVATCPSGAIYKREE
207 -> 236 GIVLIDQDKCRGWRLCISGCPYKKIYFNWK
7 -> 35 VGMVLNLDKCIGCHTCSVTCKNVWTGREG
325 -> 326 QR
358 -> 436 LSPIQSYADAGGLPKSEGVLPAIESLRIPVQYLANMLSAGDTGPVLRALKRMMAMRHYMRSQTVEGVTDTRAIDEVGLS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009325 - nitrate reductase complex
molecular_function GO:0005515 - protein binding
GO:0009055 - electron transfer activity
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008940 - nitrate reductase activity
GO:0051538 - 3 iron, 4 sulfur cluster binding
biological_process GO:0006974 - cellular response to DNA damage stimulus
GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0042126 - nitrate metabolic process
GO:0042128 - nitrate assimilation
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10323N
ECOCYC:
NARY-MONOMER
ECOLIWIKI:
b1467
INTERPRO:
IPR006547
INTERPRO:
IPR038262
INTERPRO:
IPR029263
INTERPRO:
IPR017896
MINT:
MINT-1251788
MODBASE:
P19318
PFAM:
PF14711
PFAM:
PF13247
PRIDE:
P19318
PRODB:
PRO_000023363
PROSITE:
PS51379
REFSEQ:
NP_415984
SMR:
P19318
SWISSMODEL:
P19318
UNIPROT:
P19318


Operon      
Name: narZYWV         
Operon arrangement:
Transcription unit        Promoter
narWV
narZYWV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter narZp 1542690 reverse Rpos has been proved to
Read more >
[AIPP] [1]


Evidence    

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB