RegulonDB RegulonDB 10.8: Gene Form
   

narZ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

narZ narY narU narW narV narZp narZp narWp narWp

Gene      
Name: narZ    Texpresso search in the literature
Synonym(s): ECK1462, EG10648, b1468, chlZ
Genome position(nucleotides): 1538850 <-- 1542590 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.04
External database links:  
ASAP:
ABE-0004898
CGSC:
18103
ECHOBASE:
EB0642
OU-MICROARRAY:
b1468
PortEco:
narZ
STRING:
511145.b1468
COLOMBOS: narZ


Product      
Name: nitrate reductase Z subunit α
Synonym(s): ChlZ, NarZ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 140.226
Isoelectric point: 6.649
Motif(s):
 
Type Positions Sequence
1086 -> 1199 LNFLTPHQKWGIHSTYSENLLMLTLSRGGPIVWISETDARELTIVDNDWVEVFNANGALTARAVVSQRVPPGMTMMYHAQERIMNIPGSEVTGMRGGIHNSVTRVCPKPTHMIG
2 -> 1246 SKLLDRFRYFKQKGETFADGHGQVMHSNRDWEDSYRQRWQFDKIVRSTHGVNCTGSCSWKIYVKNGLVTWEIQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSANRLKYPLIRKRLIELWREALKQHSDPVLAWASIMNDPQKCLSYKQVRGRGGFIRSNWQELNQLIAAANVWTIKTYGPDRVAGFSPIPAMSMVSYAAGTRYLSLLGGTCLSFYDWYCDLPPASPMTWGEQTDVPESADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTIAITPDYSEVAKLCDQWLAPKQGTDSALAMAMGHVILKEFHLDNPSDYFINYCRRYSDMPMLVMLEPRDDGSYVPGRMIRASDLVDGLGESNNPQWKTVAVNTAGELVVPNGSIGFRWGEKGKWNLESIAAGTETELSLTLLGQHDAVAGVAFPYFGGIENPHFRSVKHNPVLVRQLPVKNLTLVDGNTCPVVSVYDLVLANYGLDRGLEDENSAKDYAEIKPYTPAWGEQITGVPRQYIETIAREFADTAHKTHGRSMIILGAGVNHWYHMDMNYRGMINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWLPLAFALDWNRPPRQMNSTSFFYNHSSQWRYEKVSAQELLSPLADASKYSGHLIDFNVRAERMGWLPSAPQLGRNPLGIKAEADKAGLSPTEFTAQALKSGDLRMACEQPDSSSNHPRNLFVWRSNLLGSSGKGHEYMQKYLLGTESGIQGEELGASDGIKPEEVEWQTAAIEGKLDLLVTLDFRMSSTCLFSDIVLPTATWYEKDDMNTSDMHPFIHPLSAAVDPAWESRSDWEIYKGIAKAFSQVCVGHLGKETDVVLQPLLHDSPAELSQPCEVLDWRKGECDLIPGKTAPNIVAVERDYPATYERFTSLGPLMDKLGNGGKGISWNTQDEIDFLGKLNYTKRDGPAQGRPLIDTAIDASEVILALAPETNGHVAVKAWQALGEITGREHTHLALHKEDEKIRFRDIQAQPRKIISSPTWSGLESDHVSYNAGYTNVHELIPWRTLSGRQQLYQDHPWMRAFGESLVAYRPPIDTRSVSEMRQIPPNGFPEKALNFLTPHQKWGIHSTYSENLLMLTLSRGGPIVWISETDARELTIVDNDWVEVFNANGALTARAVVSQRVPPGMTMMYHAQERIMNIPGSEVTGMRGGIHNSVTRVCPKPTHMIGGYAQLAWGFNYYGTVGSNRDEFIMIRKMKNVNWLDDEGRDQVQEAKK
3 -> 40 KLLDRFRYFKQKGETFADGHGQVMHSNRDWEDSYRQRW
108 -> 832 RLKYPLIRKRLIELWREALKQHSDPVLAWASIMNDPQKCLSYKQVRGRGGFIRSNWQELNQLIAAANVWTIKTYGPDRVAGFSPIPAMSMVSYAAGTRYLSLLGGTCLSFYDWYCDLPPASPMTWGEQTDVPESADWYNSSYIIAWGSNVPQTRTPDAHFFTEVRYKGTKTIAITPDYSEVAKLCDQWLAPKQGTDSALAMAMGHVILKEFHLDNPSDYFINYCRRYSDMPMLVMLEPRDDGSYVPGRMIRASDLVDGLGESNNPQWKTVAVNTAGELVVPNGSIGFRWGEKGKWNLESIAAGTETELSLTLLGQHDAVAGVAFPYFGGIENPHFRSVKHNPVLVRQLPVKNLTLVDGNTCPVVSVYDLVLANYGLDRGLEDENSAKDYAEIKPYTPAWGEQITGVPRQYIETIAREFADTAHKTHGRSMIILGAGVNHWYHMDMNYRGMINMLIFCGCVGQSGGGWAHYVGQEKLRPQTGWLPLAFALDWNRPPRQMNSTSFFYNHSSQWRYEKVSAQELLSPLADASKYSGHLIDFNVRAERMGWLPSAPQLGRNPLGIKAEADKAGLSPTEFTAQALKSGDLRMACEQPDSSSNHPRNLFVWRSNLLGSSGKGHEYMQKYLLGTESGIQGEELGASDGIKPEEVEWQTAAIEGKLDLLVTLDFRMSSTCLFSDIVLPTATWYEKDDMNTSDMHPFIHPLSAAVDPAWESRSDWEIYKGIAKA
43 -> 107 DKIVRSTHGVNCTGSCSWKIYVKNGLVTWEIQQTDYPRTRPDLPNHEPRGCPRGASYSWYLYSAN

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.7 - anaerobic respiration
  1 - metabolism --> 1.4 - energy production/transport --> 1.4.2 - electron acceptors
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0009325 - nitrate reductase complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
GO:0008940 - nitrate reductase activity
GO:0043546 - molybdopterin cofactor binding
biological_process GO:0009061 - anaerobic respiration
GO:0019645 - anaerobic electron transport chain
GO:0042126 - nitrate metabolic process
GO:0042128 - nitrate assimilation
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10324N
ECOCYC:
NARZ-MONOMER
ECOLIWIKI:
b1468
INTERPRO:
IPR006963
INTERPRO:
IPR037943
INTERPRO:
IPR028189
INTERPRO:
IPR027467
INTERPRO:
IPR009010
INTERPRO:
IPR006657
INTERPRO:
IPR006656
INTERPRO:
IPR006655
INTERPRO:
IPR006468
MINT:
MINT-1261362
MODBASE:
P19319
PFAM:
PF00384
PFAM:
PF01568
PFAM:
PF14710
PRIDE:
P19319
PRODB:
PRO_000023364
PROSITE:
PS00932
PROSITE:
PS00551
PROSITE:
PS00490
PROSITE:
PS51669
REFSEQ:
NP_415985
SMART:
SM00926
SMR:
P19319
SWISSMODEL:
P19319
UNIPROT:
P19319


Operon      
Name: narZYWV         
Operon arrangement:
Transcription unit        Promoter
narWV
narZYWV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter narZp 1542690 reverse Rpos has been proved to
Read more >
[AIPP] [1]


Evidence    

 [AIPP] Automated inference of promoter position



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB