RegulonDB RegulonDB 10.8: Gene Form
   

nirC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysG nirC nirD nirB terminator anti-terminator anti-anti-terminator cysGp2 cysGp2 cysGp1 cysGp1

Gene      
Name: nirC    Texpresso search in the literature
Synonym(s): ECK3355, EG10654, b3367
Genome position(nucleotides): 3497003 --> 3497809 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.89
External database links:  
ASAP:
ABE-0011008
CGSC:
452
ECHOBASE:
EB0648
OU-MICROARRAY:
b3367
PortEco:
nirC
STRING:
511145.b3367
COLOMBOS: nirC


Product      
Name: nitrite transporter NirC
Synonym(s): NirC, NirC nitrite FNT transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 28.562
Isoelectric point: 8.624
Motif(s):
 
Type Positions Sequence
180 -> 200 FIAIWWCLLAFIASGYEHSIA
20 -> 247 SANNPLGFWVSSAMAGAYVGLGIILIFTLGNLLDPSVRPLVMGATFGIALTLVIIAGSELFTGHTMFLTFGVKAGSISHGQMWAILPQTWLGNLVGSVFVAMLYSWGGGSLLPVDTSIVHSVALAKTTAPAMVLFFKGALCNWLVCLAIWMALRTEGAAKFIAIWWCLLAFIASGYEHSIANMTLFALSWFGNHSEAYTLAGIGHNLLWVTLGNTLSGAVFMGLGYWY
113 -> 133 LVGSVFVAMLYSWGGGSLLPV
226 -> 246 LLWVTLGNTLSGAVFMGLGYW
26 -> 46 GFWVSSAMAGAYVGLGIILIF

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.3 - nitrogen metabolism
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0015513 - high-affinity secondary active nitrite transmembrane transporter activity
GO:0022857 - transmembrane transporter activity
biological_process GO:0015706 - nitrate transport
GO:0015707 - nitrite transport
GO:0042128 - nitrate assimilation
GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Clegg SJ., et al., 2006
[2] Jindal S., et al., 2019
External database links:  
ECOCYC:
NIRC-MONOMER
ECOLIWIKI:
b3367
INTERPRO:
IPR024002
INTERPRO:
IPR023271
INTERPRO:
IPR000292
PANTHER:
PTHR30520
PFAM:
PF01226
PRIDE:
P0AC26
PROSITE:
PS01006
PROSITE:
PS01005
REFSEQ:
YP_026212
SMR:
P0AC26
UNIPROT:
P0AC26


Operon      
Name: nirBDC-cysG         
Operon arrangement:
Transcription unit        Promoter
nirBDC-cysG
cysG
cysG


Transcriptional Regulation      
Display Regulation             
Activated by: FNR, IHF, NarL, NarP
Repressed by: CRP, H-NS, IHF, Cra, Fis


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Clegg SJ., Jia W., Cole JA., 2006, Role of the Escherichia coli nitrate transport protein, NarU, in survival during severe nutrient starvation and slow growth., Microbiology 152(Pt 7):2091-100

 [2] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195


RegulonDB