RegulonDB RegulonDB 10.6.3: Gene Form
   

sfsB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

murA ispB sfsB RcsB sfsBp sfsBp sfsBp3 sfsBp3 sfsBp2 sfsBp2 TSS_3499 TSS_3499 TSS_3498 TSS_3498

Gene      
Name: sfsB    Texpresso search in the literature
Synonym(s): ECK3177, EG10656, b3188, nlp, sfs7
Genome position(nucleotides): 3334909 --> 3335187 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.18
External database links:  
ASAP:
ABE-0010477
CGSC:
35693
ECHOBASE:
EB0650
ECOCYC:
EG10656
ECOLIHUB:
sfsB
OU-MICROARRAY:
b3188
REGULONDB:
b3188
STRING:
511145.b3188
M3D: sfsB
COLOMBOS: sfsB
PortEco: b3188


Product      
Name: putative transcriptional regulator SfsB
Synonym(s): Nlp, SfsB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 10.495
Isoelectric point: 10.54
Motif(s):
 
Type Positions Sequence
50 -> 69 EMIIAKALGTDPWVIWPSRY
7 -> 81 DWHPADIIAGLRKKGTSMAAESRRNGLSSSTLANALSRPWPKGEMIIAKALGTDPWVIWPSRYHDPQTHEFIDRT

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
biological_process GO:0006351 - transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Choi YL., et al., 1989
External database links:  
ECOCYC:
EG10656-MONOMER
ECOLIWIKI:
b3188
INTERPRO:
IPR038722
INTERPRO:
IPR010982
MODBASE:
P0ACH1
PFAM:
PF13693
PRIDE:
P0ACH1
PRODB:
PRO_000023942
PROTEINMODELPORTAL:
P0ACH1
REFSEQ:
NP_417655
SMR:
P0ACH1
SWISSMODEL:
P0ACH1
UNIPROT:
P0ACH1


Operon      
Name: sfsB         
Operon arrangement:
Transcription unit        Promoter
null


Transcriptional Regulation      
Display Regulation             
Activated by: RcsB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3498 3334281 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3499 3334302 forward nd [RS-EPT-CBR] [2]
  promoter sfsBp2 3334796 forward Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter sfsBp3 3334855 forward Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Choi YL., Nishida T., Kawamukai M., Utsumi R., Sakai H., Komano T., 1989, Cloning and sequencing of an Escherichia coli gene, nlp, highly homologous to the ner genes of bacteriophages Mu and D108., J Bacteriol 171(9):5222-5

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB