RegulonDB RegulonDB 10.8: Gene Form
   

bamC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

bamC dapA purC PurR anti-anti-terminator anti-terminator terminator TSS_2770 TSS_2770 TSS_2769 TSS_2769 bamCp bamCp TSS_2768 TSS_2768 purCp purCp TSS_2767 TSS_2767

Gene      
Name: bamC    Texpresso search in the literature
Synonym(s): ECK2473, EG10658, b2477, dapX, nlpB
Genome position(nucleotides): 2597831 <-- 2598865 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.46
External database links:  
ASAP:
ABE-0008161
CGSC:
33030
ECHOBASE:
EB0652
OU-MICROARRAY:
b2477
PortEco:
bamC
STRING:
511145.b2477
COLOMBOS: bamC


Product      
Name: outer membrane protein assembly factor BamC
Synonym(s): BamC, DapX, NlpB, lipoprotein-34
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 36.842
Isoelectric point: 5.169
Motif(s):
 
Type Positions Sequence
74 -> 102 GAVGKALDIRPPAQPLALVSGARTQFTGD
96 -> 211 RTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDK
219 -> 219 A
1 -> 24 MAYSVQKSRLAKVAGVSLVLLLAA
41 -> 342 YLEAAPLAELHAPAGMILPVTSGDYAIPVTNGSGAVGKALDIRPPAQPLALVSGARTQFTGDTASLLVENGRGNTLWPQVVSVLQAKNYTITQRDDAGQTLTTDWVQWNRLDEDEQYRGRYQISVKPQGYQQAVTVKLLNLEQAGKPVADAASMQRYSTEMMNVISAGLDKSATDAANAAQNRASTTMDVQSAADDTGLPMLVVRGPFNVVWQRLPAALEKVGMKVTDSTRSQGNMAVTYKPLSDSDWQELGASDPGLASGDYKLQVGDLDNRSSLQFIDPKGHTLTQSQNDALVAVFQAAF

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0009986 - cell surface
GO:1990063 - Bam protein complex
molecular_function GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
GO:0051205 - protein insertion into membrane
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[APPHINH] Assay of protein purified to homogeneity from its native host
[IPI] Inferred from physical interaction
Reference(s): [1] Hagan CL., et al., 2010
[2] Han L., et al., 2016
[3] Wu T., et al., 2005
External database links:  
DIP:
DIP-39898N
DISPROT:
DP01339
ECOCYC:
EG10658-MONOMER
ECOLIWIKI:
b2477
INTERPRO:
IPR042268
INTERPRO:
IPR014524
INTERPRO:
IPR010653
PDB:
3TGO
PDB:
5AYW
PDB:
5D0O
PDB:
5D0Q
PDB:
5EKQ
PDB:
5LJO
PDB:
2LAE
PDB:
3SNS
PDB:
2LAF
PDB:
2YH5
PDB:
2YH6
PFAM:
PF06804
PRIDE:
P0A903
PRODB:
PRO_000023393
PROSITE:
PS51257
REFSEQ:
NP_416972
SMR:
P0A903
UNIPROT:
P0A903


Operon      
Name: dapA-bamC         
Operon arrangement:
Transcription unit        Promoter
bamC
dapA-nlpB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2767 2597654 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2768 2598879 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2769 2599483 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_2770 2599588 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Hagan CL., Kim S., Kahne D., 2010, Reconstitution of outer membrane protein assembly from purified components., Science 328(5980):890-2

 [2] Han L., Zheng J., Wang Y., Yang X., Liu Y., Sun C., Cao B., Zhou H., Ni D., Lou J., Zhao Y., Huang Y., 2016, Structure of the BAM complex and its implications for biogenesis of outer-membrane proteins., Nat Struct Mol Biol 23(3):192-6

 [3] Wu T., Malinverni J., Ruiz N., Kim S., Silhavy TJ., Kahne D., 2005, Identification of a multicomponent complex required for outer membrane biogenesis in Escherichia coli., Cell 121(2):235-45

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB