RegulonDB RegulonDB 10.6.3: Gene Form
   

nupG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

speC nupG mltC CRP CRP CRP CytR CytR CytR CRP terminator anti-terminator anti-anti-terminator nupGp nupGp

Gene      
Name: nupG    Texpresso search in the literature
Synonym(s): ECK2959, EG10664, b2964
Genome position(nucleotides): 3105714 --> 3106970 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.72
External database links:  
ASAP:
ABE-0009728
CGSC:
442
ECHOBASE:
EB0658
ECOCYC:
EG10664
ECOLIHUB:
nupG
OU-MICROARRAY:
b2964
REGULONDB:
b2964
STRING:
511145.b2964
M3D: nupG
COLOMBOS: nupG
PortEco: b2964


Product      
Name: nucleoside:H+ symporter NupG
Synonym(s): NupG, NupG nucleoside MFS transporter
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 46.389
Isoelectric point: 8.799
Motif(s):
 
Type Positions Sequence
1 -> 406 MNLKLQLKILSFLQFCLWGSWLTTLGSYMFVTLKFDGASIGAVYSSLGIAAVFMPALLGIVADKWLSAKWVYAICHTIGAITLFMAAQVTTPEAMFLVILINSFAYMPTLGLINTISYYRLQNAGMDIVTDFPPIRIWGTIGFIMAMWVVSLSGFELSHMQLYIGAALSAILVLFTLTLPHIPVAKQQANQSWTTLLGLDAFALFKNKRMAIFFIFSMLLGAELQITNMFGNTFLHSFDKDPMFASSFIVQHASIIMSISQISETLFILTIPFFLSRYGIKNVMMISIVAWILRFALFAYGDPTPFGTVLLVLSMIVYGCAFDFFNISGSVFVEKEVSPAIRASAQGMFLMMTNGFGCILGGIVSGKVVEMYTQNGITDWQTVWLIFAGYSVVLAFAFMAMFKYKH
40 -> 60 IGAVYSSLGIAAVFMPALLGI
210 -> 230 MAIFFIFSMLLGAELQITNMF
9 -> 29 ILSFLQFCLWGSWLTTLGSYM
349 -> 369 FLMMTNGFGCILGGIVSGKVV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.33 - nucleotide and nucleoside conversions
  4 - transport --> 4.2 - Electrochemical potential driven transporters --> 4.2.A - Porters (Uni-, Sym- and Antiporters)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005337 - nucleoside transmembrane transporter activity
GO:0015213 - uridine transmembrane transporter activity
GO:0015214 - pyrimidine nucleoside transmembrane transporter activity
GO:0015506 - nucleoside:proton symporter activity
GO:0015212 - cytidine transmembrane transporter activity
biological_process GO:0015858 - nucleoside transport
GO:0015862 - uridine transport
GO:0015864 - pyrimidine nucleoside transport
GO:0072531 - pyrimidine-containing compound transmembrane transport
GO:0015860 - purine nucleoside transmembrane transport
GO:1901642 - nucleoside transmembrane transport
GO:0015861 - cytidine transport
GO:0032238 - adenosine transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
NUPG-MONOMER
ECOLIWIKI:
b2964
INTERPRO:
IPR020846
INTERPRO:
IPR036259
INTERPRO:
IPR033667
INTERPRO:
IPR004740
MODBASE:
P0AFF4
PFAM:
PF03825
PRIDE:
P0AFF4
PRODB:
PRO_000023443
PROSITE:
PS50850
PROTEINMODELPORTAL:
P0AFF4
REFSEQ:
NP_417439
UNIPROT:
P0AFF4


Operon      
Name: mutY-yggX-mltC-nupG         
Operon arrangement:
Transcription unit        Promoter
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
mutY-yggX
mutY-yggX-mltC
mutY-yggX-mltC-nupG
yggX
yggX-mltC
yggX-mltC-nupG
nupG


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, DeoR, CytR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB