RegulonDB RegulonDB 10.8: Gene Form
   

nusA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

infB nusA rimP TSS_3471 TSS_3471 TSS_3470 TSS_3470 TSS_3469 (cluster) TSS_3469 (cluster) TSS_3468 TSS_3468 TSS_3467 (cluster) TSS_3467 (cluster) nusAp nusAp TSS_3466 TSS_3466 infBp infBp TSS_3465 TSS_3465 TSS_3464 (cluster) TSS_3464 (cluster) TSS_3463 TSS_3463 TSS_3462 TSS_3462 TSS_3461 TSS_3461 TSS_3460 TSS_3460 TSS_3459 TSS_3459 TSS_3458 TSS_3458 TSS_3457 TSS_3457 TSS_3456 TSS_3456 TSS_3455 TSS_3455

Gene      
Name: nusA    Texpresso search in the literature
Synonym(s): ECK3158, EG10665, b3169
Genome position(nucleotides): 3316039 <-- 3317526 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.76
External database links:  
ASAP:
ABE-0010413
CGSC:
441
ECHOBASE:
EB0659
OU-MICROARRAY:
b3169
PortEco:
nusA
STRING:
511145.b3169
COLOMBOS: nusA


Product      
Name: transcription termination/antitermination protein NusA
Synonym(s): NusA, transcription termination/antitermination L factor
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 54.871
Isoelectric point: 4.253
Motif(s):
 
Type Positions Sequence
135 -> 200 GEIITGVVKKVNRDNISLDLGNNAEAVILREDMLPRENFRPGDRVRGVLYSVRPEARGAQLFVTRS
302 -> 368 KHTMDIAVEAGNLAQAIGRNGQNVRLASQLSGWELNVMTVDDLQAKHQAEAHAAIDTFTKYLDIDED
4 -> 123 EILAVVEAVSNEKALPREKIFEALESALATATKKKYEQEIDVRVQIDRKSGDFDTFRRWLVVDEVTQPTKEITLEAARYEDESLNLGDYVEDQIESVTFDRITTQTAKQVIVQKVREAER
439 -> 489 GVDRDLAFKLAARGVCTLEDLAEQGIDDLADIEGLTDEKAGALIMAARNIC
167 -> 191 MLPRENFRPGDRVRGVLYSVRPEAR

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0019904 - protein domain specific binding
GO:0003676 - nucleic acid binding
GO:0005515 - protein binding
GO:0003723 - RNA binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000166 - nucleotide binding
GO:0001000 - bacterial-type RNA polymerase core enzyme binding
biological_process GO:0001125 - transcription termination from bacterial-type RNA polymerase promoter
GO:0006353 - DNA-templated transcription, termination
GO:0031554 - regulation of DNA-templated transcription, termination
GO:0031564 - transcription antitermination
GO:0051259 - protein complex oligomerization
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Greenblatt J., et al., 1981
[2] Ward DF., et al., 1981
External database links:  
DIP:
DIP-47857N
ECOCYC:
EG10665-MONOMER
ECOLIWIKI:
b3169
INTERPRO:
IPR003029
INTERPRO:
IPR036555
INTERPRO:
IPR030842
INTERPRO:
IPR025249
INTERPRO:
IPR022967
INTERPRO:
IPR015946
INTERPRO:
IPR013735
INTERPRO:
IPR012340
INTERPRO:
IPR010995
INTERPRO:
IPR010214
INTERPRO:
IPR010213
INTERPRO:
IPR009019
MINT:
MINT-1220515
MODBASE:
P0AFF6
PANTHER:
PTHR22648
PDB:
1U9L
PDB:
1WCL
PDB:
1WCN
PDB:
2JZB
PDB:
6IB8
PDB:
2KWP
PDB:
5MS0
PDB:
5LM9
PDB:
6FLQ
PFAM:
PF00575
PFAM:
PF13184
PFAM:
PF08529
PRIDE:
P0AFF6
PRODB:
PRO_000023445
PROSITE:
PS50084
PROSITE:
PS50126
REFSEQ:
NP_417638
SMART:
SM00316
SMR:
P0AFF6
SWISSMODEL:
P0AFF6
UNIPROT:
P0AFF6


Operon      
Name: metY-rimP-nusA-infB-rbfA-truB-rpsO-pnp         
Operon arrangement:
Transcription unit        Promoter
pnp
rpsO
rpsO-pnp
infB
nusA-infB
rimP-nusA-infB
metY
metY-yhbC-nusA-infB
metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp
metY
metY-yhbC-nusA-infB-rbfA-truB-rpsO-pnp


Transcriptional Regulation      
Display Regulation             
Activated by: Fis
Repressed by: CRP, ArgR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3455 3314593 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3456 3315518 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3457 3315522 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3458 3315577 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3459 3315601 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3460 3315649 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3461 3315652 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3462 3315673 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3463 3315804 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3464 (cluster) 3315809 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3465 3315884 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3466 3316378 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3467 (cluster) 3317609 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3468 3317627 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3469 (cluster) 3317768 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3470 3317880 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3471 3317926 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Greenblatt J., McLimont M., Hanly S., 1981, Termination of transcription by nusA gene protein of Escherichia coli., Nature 292(5820):215-20

 [2] Ward DF., Gottesman ME., 1981, The nus mutations affect transcription termination in Escherichia coli., Nature 292(5820):212-5

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB