RegulonDB RegulonDB 10.8: Gene Form
   

ompC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ompC ftp ompC3\' micF CpxR Lrp Lrp AcrR Lrp SoxS Rob MarA Lrp IHF CpxR SoxS CpxR OmpR OmpR YjjQ OmpR Lrp Lrp Lrp Lrp Lrp Lrp Ada MicC RybB RseX anti-anti-terminator anti-terminator terminator micFp micFp ompCp3 ompCp3 ompCp2 ompCp2 ompCp1 ompCp1 TSS_2488 TSS_2488 TSS_2487 TSS_2487 TSS_2486 TSS_2486 TSS_2485 TSS_2485 TSS_2484 TSS_2484 apbEp1 apbEp1

Gene      
Name: ompC    Texpresso search in the literature
Synonym(s): ECK2207, EG10670, b2215, meoA, par
Genome position(nucleotides): 2311646 <-- 2312749 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.63
External database links:  
ASAP:
ABE-0007321
CGSC:
436
ECHOBASE:
EB0664
OU-MICROARRAY:
b2215
PortEco:
ompC
STRING:
511145.b2215
COLOMBOS: ompC


Product      
Name: outer membrane porin C
Synonym(s): MeoA, OmpC, Par, outer membrane protein 0-8, outer membrane protein 4, outer membrane protein A2, outer membrane protein Ib
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 40.368
Isoelectric point: 4.38
Motif(s):
 
Type Positions Sequence
34 -> 42 LYGKVDGLH
116 -> 133 GVVYDVTSWTDVLPEFGG
201 -> 207 VGGSITY
1 -> 21 MKVKVLSLLVPALLVAGAANA
22 -> 367 AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0045203 - integral component of cell outer membrane
GO:0046930 - pore complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0015288 - porin activity
GO:0001618 - virus receptor activity
biological_process GO:0120010 - intermembrane phospholipid transfer
GO:0006811 - ion transport
GO:0006974 - cellular response to DNA damage stimulus
GO:0046718 - viral entry into host cell
GO:0034220 - ion transmembrane transport
GO:0015914 - phospholipid transport
GO:0046813 - receptor-mediated virion attachment to host cell
Note(s): Note(s): ...[more].
Reference(s): [1] Jahn LJ., et al., 2017
[2] Lin KH., et al., 2011
[3] McBroom AJ., et al., 2006
[4] Nikaido H. 2003
[5] Nikaido H., et al., 1985
[6] Pan YH., et al., 2006
External database links:  
DIP:
DIP-10397N
ECOCYC:
EG10670-MONOMER
ECOLIWIKI:
b2215
INTERPRO:
IPR001702
INTERPRO:
IPR023614
INTERPRO:
IPR013793
INTERPRO:
IPR001897
MINT:
P06996
MODBASE:
P06996
PDB:
4A8D
PDB:
2J4U
PDB:
2ZLE
PDB:
2J1N
PFAM:
PF00267
PRIDE:
P06996
PRINTS:
PR00182
PRINTS:
PR00183
PRODB:
PRO_000023451
PROSITE:
PS00576
REFSEQ:
NP_416719
SMR:
P06996
SWISSMODEL:
P06996
UNIPROT:
P06996


Operon      
Name: ompC         
Operon arrangement:
Transcription unit        Promoter
ompC
ompC
ompC


Transcriptional Regulation      
Display Regulation             
Activated by: OmpR, CpxR, EnvY
Repressed by: YjjQ, IHF, Lrp


Regulation by small RNA    
  Display Regulation
small RNA ipeX, rseX, rybB, micC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter apbEp1 2311594 reverse Similarity to the consensus
Read more >
[ICWHO] [7]
  promoter TSS_2484 2311836 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2485 2312187 reverse nd [RS-EPT-CBR] [8]
  promoter TSS_2486 2312511 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2487 2312654 forward nd [RS-EPT-CBR] [8]
  promoter TSS_2488 2312657 reverse nd [RS-EPT-CBR] [8]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jahn LJ., Munck C., Ellabaan MMH., Sommer MOA., 2017, Adaptive Laboratory Evolution of Antibiotic Resistance Using Different Selection Regimes Lead to Similar Phenotypes and Genotypes., Front Microbiol 8:816

 [2] Lin KH., Chin WC., Lee AH., Huang CC., 2011, Genetic improvement of butanol tolerance in Escherichia coli by cell surface expression of fish metallothionein., Bioeng Bugs 2(1):55-7

 [3] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [4] Nikaido H., 2003, Molecular basis of bacterial outer membrane permeability revisited., Microbiol Mol Biol Rev 67(4):593-656

 [5] Nikaido H., Vaara M., 1985, Molecular basis of bacterial outer membrane permeability., Microbiol Rev 49(1):1-32

 [6] Pan YH., Liao CC., Kuo CC., Duan KJ., Liang PH., Yuan HS., Hu ST., Chak KF., 2006, The critical roles of polyamines in regulating ColE7 production and restricting ColE7 uptake of the colicin-producing Escherichia coli., J Biol Chem 281(19):13083-91

 [7] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [8] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB