RegulonDB RegulonDB 10.8: Gene Form
   

ompR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pck envZ ompR greB IHF CRP IHF IHF OmrB OmrA TSS_4004 TSS_4004 yhgFp2 yhgFp2 greBp7 greBp7 ompRp4 ompRp4 greBp8 greBp8 ompRp1 ompRp1 ompRp2 ompRp2 ompRp3 ompRp3 TSS_4002 TSS_4002 TSS_4001 TSS_4001

Gene      
Name: ompR    Texpresso search in the literature
Synonym(s): ECK3392, EG10672, b3405, cry, kmt, ompB
Genome position(nucleotides): 3535865 <-- 3536584 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.14
External database links:  
ASAP:
ABE-0011110
CGSC:
434
ECHOBASE:
EB0666
OU-MICROARRAY:
b3405
PortEco:
ompR
STRING:
511145.b3405
COLOMBOS: ompR


Product      
Name: DNA-binding transcriptional dual regulator OmpR
Synonym(s): Cry, Kmt, OmpB, OmpR, OmpR response regulator
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 27.354
Isoelectric point: 6.313
Motif(s):
 
Type Positions Sequence
7 -> 7 I
157 -> 232 EPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVF
6 -> 120 KILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLDLMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLARIRAVL
135 -> 234 EAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVP

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.2 - activator
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0032993 - protein-DNA complex
molecular_function GO:0003677 - DNA binding
GO:0005515 - protein binding
GO:0003700 - DNA-binding transcription factor activity
GO:0000156 - phosphorelay response regulator activity
GO:0000976 - transcription regulatory region sequence-specific DNA binding
GO:0001216 - DNA-binding transcription activator activity
biological_process GO:0006355 - regulation of transcription, DNA-templated
GO:0045893 - positive regulation of transcription, DNA-templated
GO:0000160 - phosphorelay signal transduction system
External database links:  
DIP:
DIP-31859N
ECOCYC:
OMPR-MONOMER
ECOLIWIKI:
b3405
INTERPRO:
IPR036388
INTERPRO:
IPR039420
INTERPRO:
IPR016032
INTERPRO:
IPR011006
INTERPRO:
IPR001867
INTERPRO:
IPR001789
MODBASE:
P0AA16
PANTHER:
PTHR26402
PDB:
2JPB
PDB:
1OPC
PDB:
1ODD
PFAM:
PF00072
PFAM:
PF00486
PRIDE:
P0AA16
PRODB:
PRO_000023457
PROSITE:
PS50110
PROSITE:
PS51755
REFSEQ:
NP_417864
SMART:
SM00862
SMART:
SM00448
SMR:
P0AA16
UNIPROT:
P0AA16


Operon      
Name: ompR-envZ         
Operon arrangement:
Transcription unit        Promoter
ompR-envZ
ompR-envZ
ompR-envZ
ompR-envZ


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: CRP, IHF


Regulation by small RNA    
  Display Regulation
small RNA omrA, omrB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4001 3536371 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4002 3536377 reverse nd [RS-EPT-CBR] [1]
  promoter greBp8 3536744 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter greBp7 3536780 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhgFp2 3537176 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4004 3537268 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB