RegulonDB RegulonDB 10.8: Gene Form
   

oppA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oppA insH21 oppB Fur GcvB terminator anti-terminator anti-anti-terminator terminator TSS_1660 TSS_1660 oppBp oppBp TSS_1659 TSS_1659 TSS_1658 TSS_1658 TSS_1657 TSS_1657 TSS_1656 TSS_1656 TSS_1655 TSS_1655 TSS_1654 TSS_1654 TSS_1653 TSS_1653 TSS_1652 (cluster) TSS_1652 (cluster) TSS_1651 TSS_1651 TSS_1650 TSS_1650 TSS_1649 TSS_1649 TSS_1648 TSS_1648 TSS_1647 (cluster) TSS_1647 (cluster) TSS_1646 TSS_1646 TSS_1645 (cluster) TSS_1645 (cluster) TSS_1644 TSS_1644 TSS_1643 TSS_1643 TSS_1642 TSS_1642 TSS_1641 TSS_1641 TSS_1640 (cluster) TSS_1640 (cluster) TSS_1639 (cluster) TSS_1639 (cluster) TSS_1638 (cluster) TSS_1638 (cluster) TSS_1637 (cluster) TSS_1637 (cluster) TSS_1636 (cluster) TSS_1636 (cluster) TSS_1635 (cluster) TSS_1635 (cluster) TSS_1634 TSS_1634 TSS_1633 TSS_1633 TSS_1632 TSS_1632 TSS_1631 (cluster) TSS_1631 (cluster) oppAp oppAp TSS_1630 (cluster) TSS_1630 (cluster) TSS_1629 TSS_1629 TSS_1628 (cluster) TSS_1628 (cluster) TSS_1627 TSS_1627 TSS_1626 (cluster) TSS_1626 (cluster) TSS_1625 TSS_1625 TSS_1624 (cluster) TSS_1624 (cluster) TSS_1623 TSS_1623

Gene      
Name: oppA    Texpresso search in the literature
Synonym(s): ECK1237, EG10674, b1243
Genome position(nucleotides): 1301182 --> 1302813 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.73
External database links:  
ASAP:
ABE-0004172
CGSC:
18094
ECHOBASE:
EB0668
OU-MICROARRAY:
b1243
PortEco:
oppA
STRING:
511145.b1243
COLOMBOS: oppA


Product      
Name: oligopeptide ABC transporter periplasmic binding protein
Synonym(s): OppA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,periplasmic space
Molecular weight: 60.899
Isoelectric point: 6.453
Motif(s):
 
Type Positions Sequence
314 -> 315 RV
271 -> 271 N
27 -> 543 ADVPAGVTLAEKQTLVRNNGSEVQSLDPHKIEGVPESNISRDLFEGLLVSDLDGHPAPGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMNTAHYKSPAFDSIMAETLKVTDEAQRTALYTKAEQQLDKDSAIVPVYYYVNARLVKPWVGGYTGKDPLDNTYTRNMYIVKH
83 -> 463 APGVAESWDNKDAKVWTFHLRKDAKWSDGTPVTAQDFVYSWQRSVDPNTASPYASYLQYGHIAGIDEILEGKKPITDLGVKAIDDHTLEVTLSEPVPYFYKLLVHPSTSPVPKAAIEKFGEKWTQPGNIVTNGAYTLKDWVVNERIVLERSPTYWNNAKTVINQVTYLPIASEVTDVNRYRSGEIDMTNNSMPIELFQKLKKEIPDEVHVDPYLCTYYYEINNQKPPFNDVRVRTALKLGMDRDIIVNKVKAQGNMPAYGYTPPYTDGAKLTQPEWFGWSQEKRNEEAKKLLAEAGYTADKPLTINLLYNTSDLHKKLAIAASSLWKKNIGVNVKLVNQEWKTFLDTRHQGTFDVARAGWCADYNEPTSFLNTMLSNSSMN
1 -> 26 MTNITKRSLVAAGVLAALMAGNVALA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:1900750 - oligopeptide binding
GO:1904680 - peptide transmembrane transporter activity
biological_process GO:0009408 - response to heat
GO:0015031 - protein transport
GO:0006857 - oligopeptide transport
GO:0015833 - peptide transport
GO:0055085 - transmembrane transport
GO:0061077 - chaperone-mediated protein folding
Note(s): Note(s): ...[more].
Reference(s): [1] Acosta MB., et al., 2000
[2] Igarashi K., et al., 1997
[3] Kashiwagi K., et al., 1992
[4] Maqbool A., et al., 2011
[5] Nakamatsu EH., et al., 2007
[6] Yoshida M., et al., 1999
External database links:  
DIP:
DIP-10405N
ECOCYC:
OPPA-MONOMER
ECOLIWIKI:
b1243
INTERPRO:
IPR039424
INTERPRO:
IPR030678
INTERPRO:
IPR023765
INTERPRO:
IPR000914
MODBASE:
P23843
PANTHER:
PTHR30290
PDB:
3TCH
PDB:
3TCG
PDB:
3TCF
PFAM:
PF00496
PRIDE:
P23843
PRODB:
PRO_000023461
PROSITE:
PS01040
REFSEQ:
NP_415759
SMR:
P23843
SWISSMODEL:
P23843
UNIPROT:
P23843


Operon      
Name: oppABCDF         
Operon arrangement:
Transcription unit        Promoter
oppABCDF
oppBCDF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, Lrp, ArcA, ModE


RNA cis-regulatory element    
Attenuation: Translational


Regulation by small RNA    
  Display Regulation
small RNA gcvB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1623 1300978 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1624 (cluster) 1301011 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1625 1301043 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1626 (cluster) 1301047 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1627 1301061 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1628 (cluster) 1301063 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1629 1301072 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1630 (cluster) 1301075 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1631 (cluster) 1301130 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1632 1301156 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1633 1301325 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1634 1301421 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1635 (cluster) 1301440 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1636 (cluster) 1301445 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1637 (cluster) 1301448 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1638 (cluster) 1301452 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1639 (cluster) 1301462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1640 (cluster) 1301471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1641 1301475 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1642 1301479 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1643 1301484 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1644 1301505 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1645 (cluster) 1301513 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1646 1301585 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1647 (cluster) 1301592 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1648 1301596 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1649 1301629 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1650 1301632 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1651 1301651 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1652 (cluster) 1301927 forward For this promoter, there
Read more >
[RS-EPT-CBR] [7]
  promoter TSS_1653 1301955 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1654 1301979 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1655 1302037 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1656 1302088 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1657 1302221 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1658 1302237 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1659 1302457 forward nd [RS-EPT-CBR] [7]
  promoter TSS_1660 1303510 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Acosta MB., Ferreira RC., Padilla G., Ferreira LC., Costa SO., 2000, Altered expression of oligopeptide-binding protein (OppA) and aminoglycoside resistance in laboratory and clinical Escherichia coli strains., J Med Microbiol 49(5):409-13

 [2] Igarashi K., Saisho T., Yuguchi M., Kashiwagi K., 1997, Molecular mechanism of polyamine stimulation of the synthesis of oligopeptide-binding protein., J Biol Chem 272(7):4058-64

 [3] Kashiwagi K., Miyaji A., Ikeda S., Tobe T., Sasakawa C., Igarashi K., 1992, Increase of sensitivity to aminoglycoside antibiotics by polyamine-induced protein (oligopeptide-binding protein) in Escherichia coli., J Bacteriol 174(13):4331-7

 [4] Maqbool A., Levdikov VM., Blagova EV., Herve M., Horler RS., Wilkinson AJ., Thomas GH., 2011, Compensating stereochemical changes allow murein tripeptide to be accommodated in a conventional peptide-binding protein., J Biol Chem 286(36):31512-21

 [5] Nakamatsu EH., Fujihira E., Ferreira RC., Balan A., Costa SO., Ferreira LC., 2007, Oligopeptide uptake and aminoglycoside resistance in Escherichia coli K12., FEMS Microbiol Lett 269(2):229-33

 [6] Yoshida M., Meksuriyen D., Kashiwagi K., Kawai G., Igarashi K., 1999, Polyamine stimulation of the synthesis of oligopeptide-binding protein (OppA). Involvement of a structural change of the Shine-Dalgarno sequence and the initiation codon aug in oppa mRNA., J Biol Chem 274(32):22723-8

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB