RegulonDB RegulonDB 10.8: Gene Form
   

oppB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oppA oppB oppC GcvB terminator anti-terminator anti-anti-terminator TSS_1668 TSS_1668 TSS_1667 TSS_1667 TSS_1666 TSS_1666 TSS_1665 (cluster) TSS_1665 (cluster) TSS_1664 TSS_1664 TSS_1663 TSS_1663 TSS_1662 TSS_1662 TSS_1661 (cluster) TSS_1661 (cluster) TSS_1660 TSS_1660 oppBp oppBp TSS_1659 TSS_1659 TSS_1658 TSS_1658 TSS_1657 TSS_1657 TSS_1656 TSS_1656 TSS_1655 TSS_1655 TSS_1654 TSS_1654 TSS_1653 TSS_1653 TSS_1652 (cluster) TSS_1652 (cluster) TSS_1651 TSS_1651 TSS_1650 TSS_1650 TSS_1649 TSS_1649 TSS_1648 TSS_1648 TSS_1647 (cluster) TSS_1647 (cluster) TSS_1646 TSS_1646 TSS_1645 (cluster) TSS_1645 (cluster) TSS_1644 TSS_1644 TSS_1643 TSS_1643 TSS_1642 TSS_1642 TSS_1641 TSS_1641 TSS_1640 (cluster) TSS_1640 (cluster) TSS_1639 (cluster) TSS_1639 (cluster) TSS_1638 (cluster) TSS_1638 (cluster) TSS_1637 (cluster) TSS_1637 (cluster) TSS_1636 (cluster) TSS_1636 (cluster) TSS_1635 (cluster) TSS_1635 (cluster) TSS_1634 TSS_1634 TSS_1633 TSS_1633

Gene      
Name: oppB    Texpresso search in the literature
Synonym(s): ECK1238, EG10675, b1244
Genome position(nucleotides): 1302899 --> 1303819 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
45.71
External database links:  
ASAP:
ABE-0004174
CGSC:
18091
ECHOBASE:
EB0669
OU-MICROARRAY:
b1244
PortEco:
oppB
STRING:
511145.b1244
COLOMBOS: oppB


Product      
Name: murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppB
Synonym(s): OppB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.443
Isoelectric point: 10.189
Motif(s):
 
Type Positions Sequence
100 -> 121 LGAAAFFLAVILGVSAGVIAAL
138 -> 158 GVVIPSFVVAPLLVMIFAIIL
94 -> 293 FPVSAKLGAAAFFLAVILGVSAGVIAALKQNTKWDYTVMGLAMTGVVIPSFVVAPLLVMIFAIILHWLPGGGWNGGALKFMILPMVALSLAYIASIARITRGSMIEVLHSNFIRTARAKGLPMRRIILRHALKPALLPVLSYMGPAFVGIITGSMVIETIYGLPGIGQLFVNGALNRDYSLVLSLTILVGALTILFNAIV
272 -> 293 YSLVLSLTILVGALTILFNAIV
10 -> 30 LEAIPTLFILITISFFMMRLA

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015421 - ATPase-coupled oligopeptide transmembrane transporter activity
GO:0015640 - peptidoglycan peptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0015834 - peptidoglycan-associated peptide transport
GO:0055085 - transmembrane transport
GO:0035672 - oligopeptide transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Masulis IS., et al., 2019
External database links:  
DIP:
DIP-48074N
ECOCYC:
OPPB-MONOMER
ECOLIWIKI:
b1244
INTERPRO:
IPR000515
INTERPRO:
IPR035906
PFAM:
PF00528
PRIDE:
P0AFH2
PRODB:
PRO_000023462
PROSITE:
PS50928
REFSEQ:
NP_415760
UNIPROT:
P0AFH2


Operon      
Name: oppABCDF         
Operon arrangement:
Transcription unit        Promoter
oppABCDF
oppBCDF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, Lrp, ArcA, ModE


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1633 1301325 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1634 1301421 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1635 (cluster) 1301440 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1636 (cluster) 1301445 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1637 (cluster) 1301448 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1638 (cluster) 1301452 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1639 (cluster) 1301462 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1640 (cluster) 1301471 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1641 1301475 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1642 1301479 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1643 1301484 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1644 1301505 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1645 (cluster) 1301513 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1646 1301585 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1647 (cluster) 1301592 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1648 1301596 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1649 1301629 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1650 1301632 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1651 1301651 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1652 (cluster) 1301927 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1653 1301955 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1654 1301979 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1655 1302037 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1656 1302088 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1657 1302221 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1658 1302237 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1659 1302457 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1660 1303510 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1661 (cluster) 1304145 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1662 1304149 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1663 1304195 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1664 1304234 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1665 (cluster) 1304239 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1666 1304277 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1667 1304644 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1668 1304646 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Masulis IS., Sukharycheva NA., Kiselev SS., Andreeva ZS., Ozoline ON., 2019, Between Computational Predictions and High-Throughput Transcriptional Profiling: in Depth Expression Analysis of the OppB Trans-Membrane Subunit of E. coli OppABCDF Oligopeptide Transporter., Res Microbiol

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB