RegulonDB RegulonDB 10.8: Gene Form
   

oppC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oppD oppB oppC oppF TSS_1673 (cluster) TSS_1673 (cluster) TSS_1672 TSS_1672 TSS_1671 TSS_1671 TSS_1670 TSS_1670 TSS_1669 TSS_1669 TSS_1668 TSS_1668 TSS_1667 TSS_1667 TSS_1666 TSS_1666 TSS_1665 (cluster) TSS_1665 (cluster) TSS_1664 TSS_1664 TSS_1663 TSS_1663 TSS_1662 TSS_1662 TSS_1661 (cluster) TSS_1661 (cluster) TSS_1660 TSS_1660

Gene      
Name: oppC    Texpresso search in the literature
Synonym(s): ECK1239, EG10676, b1245
Genome position(nucleotides): 1303834 --> 1304742 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.37
External database links:  
ASAP:
ABE-0004176
CGSC:
18088
ECHOBASE:
EB0670
OU-MICROARRAY:
b1245
PortEco:
oppC
STRING:
511145.b1245
COLOMBOS: oppC


Product      
Name: murein tripeptide ABC transporter / oligopeptide ABC transporter inner membrane subunit OppC
Synonym(s): OppC
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 33.022
Isoelectric point: 5.334
Motif(s):
 
Type Positions Sequence
24 -> 70 SLWQDARRRFMHNRAAVASLIVLVLIALFVILAPMLSQFAYDDTDWA
101 -> 290 GRISLMVGVAAALVAVVVGTLYGSLSGYLGGKVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMARIVRGQTLSLKRKEFIEAAQVGGVSTSGIVIRHIVPNVLGVVVVYASLLVPSMILFESFLSFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIG
140 -> 160 LLEILNSFPFMFFVILLVTFF
197 -> 216 EAAQVGGVSTSGIVIRHIVP
119 -> 300 GTLYGSLSGYLGGKVDSVMMRLLEILNSFPFMFFVILLVTFFGQNILLIFVAIGMVSWLDMARIVRGQTLSLKRKEFIEAAQVGGVSTSGIVIRHIVPNVLGVVVVYASLLVPSMILFESFLSFLGLGTQEPLSSWGALLSDGANSMEVSPWLLLFPAGFLVVTLFCFNFIGDGLRDALDPK

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
  6 - cell structure --> 6.1 - membrane
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.m - ABC superfamily, membrane component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0015421 - ATPase-coupled oligopeptide transmembrane transporter activity
GO:0015640 - peptidoglycan peptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0015834 - peptidoglycan-associated peptide transport
GO:0055085 - transmembrane transport
GO:0035672 - oligopeptide transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
OPPC-MONOMER
ECOLIWIKI:
b1245
INTERPRO:
IPR035906
INTERPRO:
IPR025966
INTERPRO:
IPR000515
PFAM:
PF00528
PFAM:
PF12911
PRIDE:
P0AFH6
PRODB:
PRO_000023463
PROSITE:
PS50928
REFSEQ:
NP_415761
SMR:
P0AFH6
UNIPROT:
P0AFH6


Operon      
Name: oppABCDF         
Operon arrangement:
Transcription unit        Promoter
oppABCDF
oppBCDF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, Lrp, ArcA, ModE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1660 1303510 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1661 (cluster) 1304145 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1662 1304149 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1663 1304195 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1664 1304234 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1665 (cluster) 1304239 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1666 1304277 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1667 1304644 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1668 1304646 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1669 1304881 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1670 1304924 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1671 1304930 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1672 1304951 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1673 (cluster) 1305684 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB