RegulonDB RegulonDB 10.8: Gene Form
   

oppD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

oppD oppF oppC yciU TSS_1674 TSS_1674 TSS_1673 (cluster) TSS_1673 (cluster) TSS_1672 TSS_1672 TSS_1671 TSS_1671 TSS_1670 TSS_1670 TSS_1669 TSS_1669 TSS_1668 TSS_1668 TSS_1667 TSS_1667 TSS_1666 TSS_1666 TSS_1665 (cluster) TSS_1665 (cluster) TSS_1664 TSS_1664 TSS_1663 TSS_1663 TSS_1662 TSS_1662 TSS_1661 (cluster) TSS_1661 (cluster)

Gene      
Name: oppD    Texpresso search in the literature
Synonym(s): ECK1240, EG10677, b1246
Genome position(nucleotides): 1304754 --> 1305767 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.78
External database links:  
ASAP:
ABE-0004178
CGSC:
18085
ECHOBASE:
EB0671
OU-MICROARRAY:
b1246
PortEco:
oppD
STRING:
511145.b1246
COLOMBOS: oppD


Product      
Name: murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD
Synonym(s): OppD
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 37.188
Isoelectric point: 5.982
Motif(s):
 
Type Positions Sequence
248 -> 312 MEYGNARDVFYQPVHPYSIGLLNAVPRLDAEGETMLTIPGNPPNLLRLPKGCPFQPRCPHAMEIC
169 -> 172 FSGG
20 -> 269 LNVKDLRVTFSTPDGDVTAVNDLNFSLRAGETLGIVGESGSGKSQTAFALMGLLAANGRIGGSATFNGREILNLPEHELNKLRAEQISMIFQDPMTSLNPYMRVGEQLMEVLMLHKNMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLVVVAGICDKVLVMYAGRTMEYGNARDVFYQPVHPYSIGLL
189 -> 196 LLIADEPT
56 -> 63 GESGSGKS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.10 - defense/survival
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.a - ABC superfamily ATP binding cytoplasmic component
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0043190 - ATP-binding cassette (ABC) transporter complex
molecular_function GO:0005515 - protein binding
GO:0016887 - ATPase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0015421 - ATPase-coupled oligopeptide transmembrane transporter activity
GO:0015640 - peptidoglycan peptide transmembrane transporter activity
biological_process GO:0015031 - protein transport
GO:0015833 - peptide transport
GO:0015834 - peptidoglycan-associated peptide transport
GO:0035672 - oligopeptide transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10408N
ECOCYC:
OPPD-MONOMER
ECOLIWIKI:
b1246
INTERPRO:
IPR013563
INTERPRO:
IPR027417
INTERPRO:
IPR017871
INTERPRO:
IPR003439
INTERPRO:
IPR003593
MINT:
MINT-1300671
MODBASE:
P76027
PFAM:
PF00005
PFAM:
PF08352
PRIDE:
P76027
PRODB:
PRO_000023464
PROSITE:
PS00211
PROSITE:
PS50893
REFSEQ:
YP_025300
SMART:
SM00382
SMR:
P76027
UNIPROT:
P76027


Operon      
Name: oppABCDF         
Operon arrangement:
Transcription unit        Promoter
oppABCDF
oppBCDF


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur, Lrp, ArcA, ModE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1661 (cluster) 1304145 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1662 1304149 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1663 1304195 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1664 1304234 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1665 (cluster) 1304239 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1666 1304277 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1667 1304644 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1668 1304646 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1669 1304881 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1670 1304924 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1671 1304930 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1672 1304951 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1673 (cluster) 1305684 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1674 1306002 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB