RegulonDB RegulonDB 10.7: Gene Form
   

osmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ddpF osmC bdm ddpD RcsB NhaR Lrp RcsB ppGpp osmCp2 osmCp2 TSS_1833 TSS_1833 osmCp1 osmCp1 bdmp bdmp

Gene      
Name: osmC    Texpresso search in the literature
Synonym(s): ECK1476, EG10680, b1482
Genome position(nucleotides): 1556625 --> 1557056 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.0
External database links:  
ASAP:
ABE-0004944
CGSC:
32184
ECHOBASE:
EB0674
OU-MICROARRAY:
b1482
PORTECO:
osmC
REGULONDB:
b1482
STRING:
511145.b1482
M3D: osmC
COLOMBOS: osmC
PortEco: b1482


Product      
Name: osmotically inducible peroxiredoxin OsmC
Synonym(s): OsmC, osmotically inducible protein
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 15.088
Isoelectric point: 5.664
Motif(s):
 
Type Positions Sequence
43 -> 138 EKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLD
2 -> 143 TIHKKGQAHWEGDIKRGKGTVSTESGVLNQQPYGFNTRFEGEKGTNPEELIGAAHAACFSMALSLMLGEAGFTPTSIDTTADVSLDKVDAGFAITKIALKSEVAVPGIDASTFDGIIQKAKAGCPVSQVLKAEITLDYQLKS

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.5 - adaptations --> 5.5.1 - osmotic pressure
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004601 - peroxidase activity
GO:0016209 - antioxidant activity
GO:0051920 - peroxiredoxin activity
GO:0042803 - protein homodimerization activity
biological_process GO:0006979 - response to oxidative stress
GO:0006972 - hyperosmotic response
GO:0055114 - oxidation-reduction process
GO:0033194 - response to hydroperoxide
GO:0098869 - cellular oxidant detoxification
External database links:  
DIP:
DIP-48058N
ECOCYC:
EG10680-MONOMER
ECOLIWIKI:
b1482
INTERPRO:
IPR036102
INTERPRO:
IPR003718
INTERPRO:
IPR015946
INTERPRO:
IPR019904
PDB:
1QWI
PDB:
1NYE
PFAM:
PF02566
PRIDE:
P0C0L2
PRODB:
PRO_000023468
PROTEINMODELPORTAL:
P0C0L2
REFSEQ:
NP_415999
SMR:
P0C0L2
UNIPROT:
P0C0L2


Operon      
Name: osmC         
Operon arrangement:
Transcription unit        Promoter
osmC
osmC


Transcriptional Regulation      
Display Regulation             
Activated by: NhaR, Lrp, RcsB
Repressed by: H-NS, Lrp


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1833 1556600 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB