RegulonDB RegulonDB 10.7: Gene Form
   

pal gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

tolB cpoB pal TSS_896 TSS_896 TSS_895 TSS_895 TSS_894 TSS_894 TSS_893 TSS_893 TSS_892 TSS_892 TSS_891 TSS_891

Gene      
Name: pal    Texpresso search in the literature
Synonym(s): ECK0730, EG10684, b0741, excC
Genome position(nucleotides): 779067 --> 779588 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.34
Reference(s): [1] Chen R., et al., 1987
External database links:  
ASAP:
ABE-0002521
CGSC:
35129
ECHOBASE:
EB0678
OU-MICROARRAY:
b0741
PORTECO:
pal
REGULONDB:
b0741
STRING:
511145.b0741
M3D: pal
COLOMBOS: pal
PortEco: b0741


Product      
Name: peptidoglycan-associated outer membrane lipoprotein Pal
Synonym(s): ExcC, Pal, Pal - outer membrane lipoprotein of the Tol-Pal system, protein 21K
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 18.824
Isoelectric point: 6.795
Motif(s):
 
Type Positions Sequence
116 -> 143 EYNISLGERRANAVKMYLQGKGVSADQI
145 -> 174 IVSYGKEKPAVLGHDEAAYSKNRRAVLVY
147 -> 150 SYGK
60 -> 173 LQMQQLQQNNIVYFDLDKYDIRSDFAQMLDAHANFLRSNPSYKVTVEGHADERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKEKPAVLGHDEAAYSKNRRAVLVY
110 -> 151 DERGTPEYNISLGERRANAVKMYLQGKGVSADQISIVSYGKE

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.1 - prophage genes and phage related functions
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0032153 - cell division site
GO:0031246 - intrinsic component of periplasmic side of cell outer membrane
molecular_function GO:0005515 - protein binding
biological_process GO:0051301 - cell division
GO:0007049 - cell cycle
Note(s): Note(s): ...[more].
Reference(s): [2] Cascales E., et al., 2004
[3] McBroom AJ., et al., 2006
External database links:  
DIP:
DIP-51001N
ECOCYC:
EG10684-MONOMER
ECOLIWIKI:
b0741
INTERPRO:
IPR014169
INTERPRO:
IPR006690
INTERPRO:
IPR006665
INTERPRO:
IPR036737
INTERPRO:
IPR039001
INTERPRO:
IPR006664
MINT:
P0A912
MODBASE:
P0A912
PDB:
2W8B
PDB:
2HQS
PDB:
1OAP
PFAM:
PF00691
PRIDE:
P0A912
PRINTS:
PR01021
PRODB:
PRO_000023487
PROSITE:
PS01068
PROSITE:
PS51123
PROSITE:
PS51257
PROTEINMODELPORTAL:
P0A912
REFSEQ:
NP_415269
SMR:
P0A912
UNIPROT:
P0A912


Operon      
Name: tolB-pal-cpoB         
Operon arrangement:
Transcription unit        Promoter
tolB-pal-ybgF
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_891 777769 forward nd [RS-EPT-CBR] [4]
  promoter TSS_892 778129 forward nd [RS-EPT-CBR] [4]
  promoter TSS_893 778824 forward nd [RS-EPT-CBR] [4]
  promoter TSS_894 778979 forward nd [RS-EPT-CBR] [4]
  promoter TSS_895 779058 forward nd [RS-EPT-CBR] [4]
  promoter TSS_896 779365 forward nd [RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chen R., Henning U., 1987, Nucleotide sequence of the gene for the peptidoglycan-associated lipoprotein of Escherichia coli K12., Eur J Biochem 163(1):73-7

 [2] Cascales E., Lloubes R., 2004, Deletion analyses of the peptidoglycan-associated lipoprotein Pal reveals three independent binding sequences including a TolA box., Mol Microbiol 51(3):873-85

 [3] McBroom AJ., Johnson AP., Vemulapalli S., Kuehn MJ., 2006, Outer membrane vesicle production by Escherichia coli is independent of membrane instability., J Bacteriol 188(15):5385-92

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB