RegulonDB RegulonDB 10.8: Gene Form
   

pcnB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pcnB gluQ yadN folK DksA-ppGpp DksA-ppGpp DksA-ppGpp DksA-ppGpp ppGpp ppGpp pcnBp4 pcnBp4 pcnBp2 pcnBp2 pcnBp3 pcnBp3 pcnBp1 pcnBp1 yadNp7 yadNp7 yadNp8 yadNp8 yadNp1 yadNp1

Gene      
Name: pcnB    Texpresso search in the literature
Synonym(s): ECK0142, EG10690, b0143
Genome position(nucleotides): 157729 <-- 159126 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.87
External database links:  
ASAP:
ABE-0000493
CGSC:
13584
ECHOBASE:
EB0684
MIM:
616084
MIM:
616959
OU-MICROARRAY:
b0143
PortEco:
pcnB
STRING:
511145.b0143
COLOMBOS: pcnB


Product      
Name: poly(A) polymerase I
Synonym(s): PAP I, PcnB
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane,cytosol
Molecular weight: 53.871
Isoelectric point: 10.116
Motif(s):
 
Type Positions Sequence
315 -> 315 A
1 -> 10 MFTRVANFCR
11 -> 465 KVLSREESEAEQAVARPQVTVIPREQHAISRKDISENALKVMYRLNKAGYEAWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMKDLKDGVIRLIGNPETRYREDPVRMLRAVRFAAKLGMRISPETAEPIPRLATLLNDIPPARLFEESLKLLQAGYGYETYKLLCEYHLFQPLFPTITRYFTENGDSPMERIIEQVLKNTDTRIHNDMRVNPAFLFAAMFWYPLLETAQKIAQESGLTYHDAFALAMNDVLDEACRSLAIPKRLTTLTRDIWQLQLRMSRRQGKRAWKLLEHPKFRAAYDLLALRAEVERNAELQRLVKWWGEFQVSAPPDQKGMLNELDEEPSPRRRTRRPRKRAPRREGTA
62 -> 193 AWLVGGGVRDLLLGKKPKDFDVTTNATPEQVRKLFRNCRLVGRRFRLAHVMFGPEIIEVATFRGHHEGNVSDRTTSQRGQNGMLLRDNIFGSIEEDAQRRDFTINSLYYSVADFTVRDYVGGMKDLKDGVIR
437 -> 438 ML

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
GO:0005886 - plasma membrane
molecular_function GO:0016779 - nucleotidyltransferase activity
GO:0016740 - transferase activity
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004652 - polynucleotide adenylyltransferase activity
biological_process GO:0006276 - plasmid maintenance
GO:0009451 - RNA modification
GO:0006396 - RNA processing
GO:0006397 - mRNA processing
GO:0006378 - mRNA polyadenylation
GO:0043631 - RNA polyadenylation
Note(s): Note(s): ...[more].
Reference(s): [1] Cho HD., et al., 2007
[2] Just A., et al., 2008
External database links:  
DIP:
DIP-47859N
ECOCYC:
EG10690-MONOMER
ECOLIWIKI:
b0143
INTERPRO:
IPR025866
INTERPRO:
IPR032828
INTERPRO:
IPR010206
INTERPRO:
IPR002646
MODBASE:
P0ABF1
PANTHER:
PTHR13734:SF5
PFAM:
PF12626
PFAM:
PF12627
PFAM:
PF01743
PRIDE:
P0ABF1
PRODB:
PRO_000023500
REFSEQ:
NP_414685
SMR:
P0ABF1
UNIPROT:
P0ABF1


Operon      
Name: pcnB-folK         
Operon arrangement:
Transcription unit        Promoter
pcnB-folK
pcnB-folK
pcnB-folK
pcnB-folk


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yadNp1 156984 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yadNp8 157031 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter yadNp7 157055 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Cho HD., Verlinde CL., Weiner AM., 2007, Reengineering CCA-adding enzymes to function as (U,G)- or dCdCdA-adding enzymes or poly(C,A) and poly(U,G) polymerases., Proc Natl Acad Sci U S A 104(1):54-9

 [2] Just A., Butter F., Trenkmann M., Heitkam T., Morl M., Betat H., 2008, A comparative analysis of two conserved motifs in bacterial poly(A) polymerase and CCA-adding enzyme., Nucleic Acids Res 36(16):5212-20

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB