RegulonDB RegulonDB 10.7: Gene Form
   

pflB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pflB focA pflA Fis anti-terminator terminator terminator TSS_1167 (cluster) TSS_1167 (cluster) TSS_1166 (cluster) TSS_1166 (cluster) TSS_1165 TSS_1165 TSS_1164 TSS_1164 TSS_1163 TSS_1163 TSS_1162 TSS_1162 TSS_1161 TSS_1161 pflBp5 pflBp5 TSS_1160 TSS_1160 TSS_1159 TSS_1159 pflBp4 pflBp4 TSS_1158 (cluster) TSS_1158 (cluster) TSS_1157 TSS_1157 TSS_1156 (cluster) TSS_1156 (cluster) pflBp3 pflBp3 TSS_1155 TSS_1155 TSS_1154 TSS_1154 pflBp2 pflBp2 pflBp1 pflBp1 TSS_1151 TSS_1151 TSS_1150 TSS_1150 TSS_1149 TSS_1149 TSS_1148 TSS_1148 TSS_1147 TSS_1147 TSS_1146 TSS_1146 TSS_1145 TSS_1145 TSS_1144 (cluster) TSS_1144 (cluster) TSS_1143 TSS_1143 TSS_1142 (cluster) TSS_1142 (cluster) TSS_1141 TSS_1141 TSS_1140 TSS_1140 TSS_1139 TSS_1139 TSS_1138 (cluster) TSS_1138 (cluster) TSS_1137 TSS_1137 TSS_1136 TSS_1136 TSS_1135 TSS_1135 TSS_1134 TSS_1134 TSS_1133 TSS_1133 TSS_1132 (cluster) TSS_1132 (cluster) TSS_1131 TSS_1131 TSS_1130 TSS_1130 TSS_1129 TSS_1129 TSS_1128 TSS_1128 TSS_1127 TSS_1127 TSS_1126 TSS_1126 TSS_1125 TSS_1125 TSS_1124 (cluster) TSS_1124 (cluster) TSS_1123 TSS_1123 TSS_1122 TSS_1122 TSS_1121 TSS_1121 TSS_1120 TSS_1120 TSS_1119 TSS_1119 TSS_1118 TSS_1118 TSS_1117 (cluster) TSS_1117 (cluster) TSS_1116 (cluster) TSS_1116 (cluster) TSS_1115 (cluster) TSS_1115 (cluster) TSS_1114 TSS_1114 TSS_1113 TSS_1113 TSS_1112 TSS_1112 TSS_1111 (cluster) TSS_1111 (cluster) TSS_1110 TSS_1110 TSS_1109 TSS_1109 TSS_1108 TSS_1108 TSS_1107 TSS_1107 TSS_1106 TSS_1106 TSS_1105 (cluster) TSS_1105 (cluster) TSS_1104 TSS_1104 pflAp8 pflAp8 TSS_1103 TSS_1103 pflAp pflAp TSS_1102 TSS_1102 TSS_1101 TSS_1101 TSS_1100 TSS_1100 TSS_1099 TSS_1099

Gene      
Name: pflB    Texpresso search in the literature
Synonym(s): ECK0894, EG10701, b0903, pfl
Genome position(nucleotides): 951272 <-- 953554 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.2
Reference(s): [1] Pecher A., et al., 1982
[2] Rasmussen LJ., et al., 1991
[3] Rodel W., et al., 1988
[4] Sawers G., et al., 1988
External database links:  
ASAP:
ABE-0003071
CGSC:
410
ECHOBASE:
EB0695
OU-MICROARRAY:
b0903
PORTECO:
pflB
REGULONDB:
b0903
STRING:
511145.b0903
M3D: pflB
COLOMBOS: pflB
PortEco: b0903


Shine dalgarno      
Sequence: acttaagaagGTAGGTgttaCAT


Product      
Name: pyruvate formate-lyase
Synonym(s): Pfl, PflB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 85.357
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
3 -> 625 ELNEKLATAWEGFTKGDWQNEVNVRDFIQKNYTPYEGDESFLAGATEATTTLWDKVMEGVKLENRTHAPVDFDTAVASTITSHDAGYINKQLEKIVGLQTEAPLKRALIPFGGIKMIEGSCKAYNRELDPMIKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIGDYRRVALYGIDYLMKDKLAQFTSLQADLENGVNLEQTIRLREEIAEQHRALGQMKEMAAKYGYDISGPATNAQEAIQWTYFGYLAAVKSQNGAAMSFGRTSTFLDVYIERDLKAGKITEQEAQEMVDHLVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKNSFRFLNTLYTMGPSPEPNMTILWSEKLPLNFKKFAAKVSIDTSSLQYENDDLMRPDFNNDDYAIACCVSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKSEPIKGDVLNYDEVMERMDHFMDWLAKQYITALNIIHYMHDKYSYEASLMALHDRDVIRTMACGIAGLSVAADSLSAIKYAKVKPIRDEDGLAIDFEIEGEYPQFGNNDPRVDDLAVDLVERFMKKIQKLHTYRDAIPTQSVLTITSNVVYGKKTGNTPDGRR
630 -> 741 FGPGANPMHGRDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDDEVRKTNLAGLMDGYFHHEASIEGGQHLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFN
2 -> 760 SELNEKLATAWEGFTKGDWQNEVNVRDFIQKNYTPYEGDESFLAGATEATTTLWDKVMEGVKLENRTHAPVDFDTAVASTITSHDAGYINKQLEKIVGLQTEAPLKRALIPFGGIKMIEGSCKAYNRELDPMIKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIGDYRRVALYGIDYLMKDKLAQFTSLQADLENGVNLEQTIRLREEIAEQHRALGQMKEMAAKYGYDISGPATNAQEAIQWTYFGYLAAVKSQNGAAMSFGRTSTFLDVYIERDLKAGKITEQEAQEMVDHLVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKNSFRFLNTLYTMGPSPEPNMTILWSEKLPLNFKKFAAKVSIDTSSLQYENDDLMRPDFNNDDYAIACCVSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKSEPIKGDVLNYDEVMERMDHFMDWLAKQYITALNIIHYMHDKYSYEASLMALHDRDVIRTMACGIAGLSVAADSLSAIKYAKVKPIRDEDGLAIDFEIEGEYPQFGNNDPRVDDLAVDLVERFMKKIQKLHTYRDAIPTQSVLTITSNVVYGKKTGNTPDGRRAGAPFGPGANPMHGRDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDDEVRKTNLAGLMDGYFHHEASIEGGQHLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM
23 -> 614 EVNVRDFIQKNYTPYEGDESFLAGATEATTTLWDKVMEGVKLENRTHAPVDFDTAVASTITSHDAGYINKQLEKIVGLQTEAPLKRALIPFGGIKMIEGSCKAYNRELDPMIKKIFTEYRKTHNQGVFDVYTPDILRCRKSGVLTGLPDAYGRGRIIGDYRRVALYGIDYLMKDKLAQFTSLQADLENGVNLEQTIRLREEIAEQHRALGQMKEMAAKYGYDISGPATNAQEAIQWTYFGYLAAVKSQNGAAMSFGRTSTFLDVYIERDLKAGKITEQEAQEMVDHLVMKLRMVRFLRTPEYDELFSGDPIWATESIGGMGLDGRTLVTKNSFRFLNTLYTMGPSPEPNMTILWSEKLPLNFKKFAAKVSIDTSSLQYENDDLMRPDFNNDDYAIACCVSPMIVGKQMQFFGARANLAKTMLYAINGGVDEKLKMQVGPKSEPIKGDVLNYDEVMERMDHFMDWLAKQYITALNIIHYMHDKYSYEASLMALHDRDVIRTMACGIAGLSVAADSLSAIKYAKVKPIRDEDGLAIDFEIEGEYPQFGNNDPRVDDLAVDLVERFMKKIQKLHTYRDAIPTQSVLTITSNVVYG
632 -> 760 PGANPMHGRDQKGAVASLTSVAKLPFAYAKDGISYTFSIVPNALGKDDEVRKTNLAGLMDGYFHHEASIEGGQHLNVNVMNREMLLDAMENPEKYPQLTIRVSGYAVRFNSLTKEQQQDVITRTFTQSM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.3 - energy metabolism, carbon --> 1.3.5 - fermentation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0008861 - formate C-acetyltransferase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006006 - glucose metabolic process
GO:0006567 - threonine catabolic process
External database links:  
DIP:
DIP-10467N
ECOCYC:
PYRUVFORMLY-MONOMER
ECOLIWIKI:
b0903
INTERPRO:
IPR019777
INTERPRO:
IPR005949
INTERPRO:
IPR004184
INTERPRO:
IPR001150
MINT:
MINT-1283506
MODBASE:
P09373
PDB:
3PFL
PDB:
2PFL
PDB:
1QHM
PDB:
1MZO
PDB:
1H18
PDB:
1H17
PDB:
1H16
PDB:
1CM5
PFAM:
PF02901
PFAM:
PF01228
PRIDE:
P09373
PRODB:
PRO_000023517
PROSITE:
PS51149
PROSITE:
PS51554
PROSITE:
PS00850
PROTEINMODELPORTAL:
P09373
REFSEQ:
NP_415423
SMR:
P09373
UNIPROT:
P09373


Operon      
Name: focA-pflB         
Operon arrangement:
Transcription unit        Promoter
pflB
pflB
pflB
pflB
pflB
focA-pflB
focA-pflB
focA-pflB


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR, IHF, ArcA
Repressed by: NarL, Fis


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1099 950823 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1100 950832 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1101 950837 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1102 950916 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1103 951155 reverse nd [RS-EPT-CBR] [5]
  promoter pflAp8 951228 reverse Similarity to the consensus
Read more >
[ICWHO] [6]
  promoter TSS_1104 951504 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1105 (cluster) 951515 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1106 951822 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1107 951845 forward nd [RS-EPT-CBR] [5]
  promoter TSS_1108 952063 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1109 952068 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1110 952083 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1111 (cluster) 952140 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1112 952158 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1113 952163 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1114 952167 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1115 (cluster) 952170 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1116 (cluster) 952183 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1117 (cluster) 952196 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1118 952199 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1119 952267 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1120 952271 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1121 952279 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1122 952397 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1123 952407 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1124 (cluster) 952421 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1125 952437 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1126 952443 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1127 952470 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1128 952479 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1129 952493 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1130 952584 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1131 952658 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1132 (cluster) 952666 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1133 952674 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1134 952677 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1135 953144 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1136 953146 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1137 953199 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1138 (cluster) 953225 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1139 953227 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1140 953229 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1141 953233 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1142 (cluster) 953251 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1143 953262 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1144 (cluster) 953311 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1145 953356 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1146 953449 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1147 953452 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1148 953454 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1149 953456 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1150 953537 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1151 953573 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1154 953645 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1155 953648 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1156 (cluster) 953745 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1157 953777 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1158 (cluster) 953824 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1159 953919 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1160 953922 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1161 954185 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1162 954226 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1163 954310 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1164 954317 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1165 954328 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_1166 (cluster) 954442 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]
  promoter TSS_1167 (cluster) 954449 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Pecher A., Blaschkowski HP., Knappe K., Bock A., 1982, Expression of pyruvate formate-lyase of Escherichia coli from the cloned structural gene., Arch Microbiol 132(4):365-71

 [2] Rasmussen LJ., Moller PL., Atlung T., 1991, Carbon metabolism regulates expression of the pfl (pyruvate formate-lyase) gene in Escherichia coli., J Bacteriol 173(20):6390-7

 [3] Rodel W., Plaga W., Frank R., Knappe J., 1988, Primary structures of Escherichia coli pyruvate formate-lyase and pyruvate-formate-lyase-activating enzyme deduced from the DNA nucleotide sequences., Eur J Biochem 177(1):153-8

 [4] Sawers G., Bock A., 1988, Anaerobic regulation of pyruvate formate-lyase from Escherichia coli K-12., J Bacteriol 170(11):5330-6

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB