RegulonDB RegulonDB 10.7: Gene Form
   

pgpA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

thiL yajO pgpA nusB TSS_536 TSS_536

Gene      
Name: pgpA    Texpresso search in the literature
Synonym(s): ECK0412, EG10704, b0418, yajN
Genome position(nucleotides): 436589 --> 437107 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.18
External database links:  
ASAP:
ABE-0001454
CGSC:
17644
ECHOBASE:
EB0698
OU-MICROARRAY:
b0418
PORTECO:
pgpA
REGULONDB:
b0418
STRING:
511145.b0418
M3D: pgpA
COLOMBOS: pgpA
PortEco: b0418


Product      
Name: phosphatidylglycerophosphatase A
Synonym(s): PgpA, YajN
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 19.418
Isoelectric point: 7.732
Motif(s):
 
Type Positions Sequence
22 -> 162 HLLAVGFGSGLSPIVPGTMGSLAAIPFWYLMTFLPWQLYSLVVMLGICIGVYLCHQTAKDMGVHDHGSIVWDEFIGMWITLMALPTNDWQWVAAGFVIFRILDMWKPWPIRWFDRNVHGGMGIMIDDIVAGVISAGILYFI
32 -> 52 LSPIVPGTMGSLAAIPFWYLM
142 -> 162 MGIMIDDIVAGVISAGILYFI
54 -> 74 FLPWQLYSLVVMLGICIGVYL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0008962 - phosphatidylglycerophosphatase activity
GO:0042577 - lipid phosphatase activity
biological_process GO:0006629 - lipid metabolic process
GO:0046474 - glycerophospholipid biosynthetic process
GO:0016042 - lipid catabolic process
GO:0009395 - phospholipid catabolic process
GO:0032026 - response to magnesium ion
GO:0006655 - phosphatidylglycerol biosynthetic process
GO:0046839 - phospholipid dephosphorylation
Note(s): Note(s): ...[more].
Reference(s): [1] Funk CR., et al., 1992
External database links:  
ECOCYC:
PGPPHOSPHAA-MONOMER
ECOLIWIKI:
b0418
INTERPRO:
IPR007686
INTERPRO:
IPR026037
INTERPRO:
IPR036681
PANTHER:
PTHR36305
PFAM:
PF04608
PRIDE:
P18200
PRODB:
PRO_000023525
PROTEINMODELPORTAL:
P18200
REFSEQ:
NP_414952
SMR:
P18200
UNIPROT:
P18200


Operon      
Name: nrdR-ribDE-nusB-thiL-pgpA         
Operon arrangement:
Transcription unit        Promoter
nrdR-ribDE-nusB-thiL-pgpA
ribE-nusB-thiL-pgpA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_536 436581 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Funk CR., Zimniak L., Dowhan W., 1992, The pgpA and pgpB genes of Escherichia coli are not essential: evidence for a third phosphatidylglycerophosphate phosphatase., J Bacteriol 174(1):205-13

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB