RegulonDB RegulonDB 10.7: Gene Form
   

pgsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

uvrC pgsA glyW uvrY TSS_2247 TSS_2247 glyWp glyWp leuZp3 leuZp3

Gene      
Name: pgsA    Texpresso search in the literature
Synonym(s): ECK1911, EG10706, b1912
Genome position(nucleotides): 1992269 <-- 1992817 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.46
External database links:  
ASAP:
ABE-0006367
CGSC:
405
ECHOBASE:
EB0700
OU-MICROARRAY:
b1912
PORTECO:
pgsA
REGULONDB:
b1912
STRING:
511145.b1912
M3D: pgsA
COLOMBOS: pgsA
PortEco: b1912


Product      
Name: CDP-diacylglycerol—glycerol-3-phosphate 3-phosphatidyltransferase
Synonym(s): PgsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 20.701
Isoelectric point: 9.107
Motif(s):
 
Type Positions Sequence
2 -> 182 QFNIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVADKVLVAIAMVLVTEHYHSWWVTLPAATMIAREIIISALREWMAELGKRSSVAVSWIGKVKTTAQMVALAWLLWRPNIWVEYAGIALFFVAAVLTLWSMLQYLSAARADLLDQ
14 -> 38 VILIPFFVLVFYLPVTWSPFAAALI
62 -> 82 FGAFLDPVADKVLVAIAMVLV
60 -> 60 T
4 -> 71 NIPTLLTLFRVILIPFFVLVFYLPVTWSPFAAALIFCVAAVTDWFDGFLARRWNQSTRFGAFLDPVAD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.1 - phospholipid
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016780 - phosphotransferase activity, for other substituted phosphate groups
GO:0008444 - CDP-diacylglycerol-glycerol-3-phosphate 3-phosphatidyltransferase activity
biological_process GO:0006629 - lipid metabolic process
GO:0008654 - phospholipid biosynthetic process
GO:0046474 - glycerophospholipid biosynthetic process
GO:0006655 - phosphatidylglycerol biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Miyazaki C., et al., 1985
External database links:  
ECOCYC:
PHOSPHAGLYPSYN-MONOMER
ECOLIWIKI:
b1912
INTERPRO:
IPR004570
INTERPRO:
IPR000462
INTERPRO:
IPR023762
PFAM:
PF01066
PRIDE:
P0ABF8
PRODB:
PRO_000023527
PROSITE:
PS00379
PROTEINMODELPORTAL:
P0ABF8
REFSEQ:
NP_416422
SMR:
P0ABF8
UNIPROT:
P0ABF8


Operon      
Name: pgsA         
Operon arrangement:
Transcription unit        Promoter
pgsA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter leuZp3 1992050 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2247 1992850 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Miyazaki C., Kuroda M., Ohta A., Shibuya I., 1985, Genetic manipulation of membrane phospholipid composition in Escherichia coli: pgsA mutants defective in phosphatidylglycerol synthesis., Proc Natl Acad Sci U S A 82(22):7530-4

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB