RegulonDB RegulonDB 10.8: Gene Form
   

pheA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pheA tyrA pheL Cis-reg; leader terminator anti-terminator anti-anti-terminator TSS_2941 TSS_2941 TSS_2940 TSS_2940

Gene      
Name: pheA    Texpresso search in the literature
Synonym(s): ECK2596, EG10707, b2599
Genome position(nucleotides): 2737745 --> 2738905 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.18
External database links:  
ASAP:
ABE-0008545
CGSC:
403
ECHOBASE:
EB0701
OU-MICROARRAY:
b2599
PortEco:
pheA
STRING:
511145.b2599
COLOMBOS: pheA


Product      
Name: fused chorismate mutase/prephenate dehydratase
Synonym(s): PheA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.111
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
39 -> 39 K
52 -> 52 E
1 -> 92 MTSENPLLALREKISALDEKLLALLAERRELAVEVGKAKLLSHRPVRDIDRERDLLERLITLGKAHHLDAHYITRLFQLIIEDSVLTQQALL
28 -> 28 R
88 -> 88 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.13 - phenylalanine
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.14 - tyrosine
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016829 - lyase activity
GO:0016853 - isomerase activity
GO:0004106 - chorismate mutase activity
GO:0004664 - prephenate dehydratase activity
GO:0042803 - protein homodimerization activity
biological_process GO:0008152 - metabolic process
GO:0006571 - tyrosine biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0009073 - aromatic amino acid family biosynthetic process
GO:0009094 - L-phenylalanine biosynthetic process
GO:0046417 - chorismate metabolic process
External database links:  
DIP:
DIP-36017N
ECOCYC:
CHORISMUTPREPHENDEHYDRAT-MONOMER
ECOLIWIKI:
b2599
INTERPRO:
IPR036263
INTERPRO:
IPR036979
INTERPRO:
IPR018528
INTERPRO:
IPR010952
INTERPRO:
IPR008242
INTERPRO:
IPR002912
INTERPRO:
IPR002701
INTERPRO:
IPR001086
MINT:
MINT-1248118
MODBASE:
P0A9J8
PDB:
1ECM
PDB:
5VHT
PFAM:
PF00800
PFAM:
PF01817
PRIDE:
P0A9J8
PRODB:
PRO_000023528
PROSITE:
PS51171
PROSITE:
PS51671
PROSITE:
PS00857
PROSITE:
PS00858
PROSITE:
PS51168
REFSEQ:
NP_417090
SMART:
SM00830
SMR:
P0A9J8
SWISSMODEL:
P0A9J8
UNIPROT:
P0A9J8


Operon      
Name: pheLA         
Operon arrangement:
Transcription unit        Promoter
pheLA


RNA cis-regulatory element    
Attenuation: Transcriptional
   
Cis-reg; leader Phenylalanine leader peptide
   
   


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2940 2737804 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2941 2739800 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB