RegulonDB RegulonDB 10.8: Gene Form
   

pheS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pheT pheS pheM IHF IHF IHF Cis-reg; leader anti-anti-terminator anti-terminator terminator TSS_2012 TSS_2012 TSS_2011 TSS_2011 TSS_2010 TSS_2010 TSS_2009 TSS_2009 TSS_2008 TSS_2008 TSS_2007 TSS_2007 ihfAp4 ihfAp4 TSS_2006 TSS_2006 TSS_2005 TSS_2005

Gene      
Name: pheS    Texpresso search in the literature
Synonym(s): ECK1712, EG10709, b1714, phe-act
Genome position(nucleotides): 1797959 <-- 1798942 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.86
External database links:  
ASAP:
ABE-0005722
CGSC:
400
ECHOBASE:
EB0703
MIM:
614946
MIM:
617046
OU-MICROARRAY:
b1714
PortEco:
pheS
STRING:
511145.b1714
COLOMBOS: pheS


Product      
Name: phenylalanine—tRNA ligase subunit α
Synonym(s): PheS
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.832
Isoelectric point: 6.135
Motif(s):
 
Type Positions Sequence
74 -> 74 R
92 -> 326 IDVSLPGRRIENGGLHPVTRTIDRIESFFGELGFTVATGPEIEDDYHNFDALNIPGHHPARADHDTFWFDTTRLLRTQTSGVQIRTMKAQQPPIRIIAPGRVYRNDYDQTHTPMFHQMEGLIVDTNISFTNLKGTLHDFLRNFFEEDLQIRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNVLRNVGIDPEVYSGFAFGMGMERLTMLRYGVTDLRSFFENDLRFLKQF
20 -> 87 DVAALDNVRVEYLGKKGHLTLQMTTLRELPPEERPAAGAVINEAKEQVQQALNARKAELESAALNARL
191 -> 191 G
98 -> 98 G

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.1 - amino acid -activation
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0009328 - phenylalanine-tRNA ligase complex
molecular_function GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016874 - ligase activity
GO:0004812 - aminoacyl-tRNA ligase activity
GO:0004826 - phenylalanine-tRNA ligase activity
GO:0000049 - tRNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000287 - magnesium ion binding
biological_process GO:0006412 - translation
GO:0043039 - tRNA aminoacylation
GO:0006432 - phenylalanyl-tRNA aminoacylation
Note(s): Note(s): ...[more].
Reference(s): [1] Ashwin Sri Bala S., et al., 2018
[2] Comer MM., et al., 1976
[3] Miyazaki K. 2015
[4] Ponmani T., et al., 2014
External database links:  
DIP:
DIP-6878N
ECOCYC:
PHES-MONOMER
ECOLIWIKI:
b1714
INTERPRO:
IPR006195
INTERPRO:
IPR010978
INTERPRO:
IPR004529
INTERPRO:
IPR002319
INTERPRO:
IPR022911
INTERPRO:
IPR004188
MINT:
MINT-1229741
MODBASE:
P08312
PANTHER:
PTHR11538:SF48
PDB:
3PCO
PFAM:
PF02912
PFAM:
PF01409
PRIDE:
P08312
PROSITE:
PS50862
REFSEQ:
NP_416229
SMR:
P08312
SWISSMODEL:
P08312
UNIPROT:
P08312


Operon      
Name: thrS-infC-rpmI-rplT-pheMST-ihfA         
Operon arrangement:
Transcription unit        Promoter
ihfA
pheM
pheMST-ihfA
rplT
rplT-pheM
rpmI-rplT
infC-rpmI-rplT
infC
thrS-infC
thrS-infC-rpmI-rplT-pheMST-ihfA


Transcriptional Regulation      
Display Regulation             
Repressed by: NsrR


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2005 1795580 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2006 1795720 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2007 1795767 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2008 1795965 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2009 1797601 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2010 1798580 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2011 1798597 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_2012 1799135 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Ashwin Sri Bala S., Madhumathi I., Vinodha S., Munavar MH., 2018, Glu571 of PheT plays a pivotal role in the thermal stability of Escherichia coli PheRS enzyme., J Basic Microbiol 58(6):475-491

 [2] Comer MM., Bock A., 1976, Genes for the alpha and beta subunits of the phenylalanyl-transfer ribonucleic acid synthetase of Escherichia coli., J Bacteriol 127(2):923-33

 [3] Miyazaki K., 2015, Molecular engineering of a PheS counterselection marker for improved operating efficiency in Escherichia coli., Biotechniques 58(2):86-8

 [4] Ponmani T., Munavar MH., 2014, G673 could be a novel mutational hot spot for intragenic suppressors of pheS5 lesion in Escherichia coli., Microbiologyopen 3(3):369-82

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB