RegulonDB RegulonDB 10.9: Gene Form
   

phnI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnI phnJ phnK phnH phnG

Gene      
Name: phnI    Texpresso search in the literature
Synonym(s): ECK4092, EG10718, b4099
Genome position(nucleotides): 4319599 <-- 4320663 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
62.63
External database links:  
ASAP:
ABE-0013428
CGSC:
34538
ECHOBASE:
EB0712
ECOLIHUB:
phnI
OU-MICROARRAY:
b4099
STRING:
511145.b4099
COLOMBOS: phnI


Product      
Name: carbon-phosphorus lyase core complex subunit PhnI
Synonym(s): PhnI, PhnI subunit of methylphosphonate degradation complex
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 38.853
Isoelectric point: 4.685
Motif(s):
 
Type Positions Sequence
1 -> 350 MYVAVKGGEKAIDAAHALQESRRRGDTDLPELSVAQIEQQLNLAVDRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTGMRLERRISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGEAPTLTTADSEQQPSPHVFSLLARQGLAKFEEDSGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRNHPFAGEIRSGYIDVSIVPEELGFAVNVGELLMTECEMVNGFIDPPGEPPHFTRGYGLVFGMSERKAMAMALVDRALQAPEYGEHATGPAQDEEFVLAHADNVEAAGFVSHLKLPHYVDFQAELELLKRLQQE
264 -> 264 G
351 -> 351 Q

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:1904176 - carbon phosphorus lyase complex
GO:0005829 - cytosol
GO:0061694 - alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase complex
molecular_function GO:0005515 - protein binding
GO:0016740 - transferase activity
GO:0061693 - alpha-D-ribose 1-methylphosphonate 5-triphosphate synthase activity
biological_process GO:0019634 - organic phosphonate metabolic process
GO:0019700 - organic phosphonate catabolic process
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Metcalf WW., et al., 1993
External database links:  
DIP:
DIP-10488N
ECOCYC:
EG10718-MONOMER
ECOLIWIKI:
b4099
INTERPRO:
IPR008773
PDB:
4XB6
PFAM:
PF05861
PRIDE:
P16687
PRODB:
PRO_000023535
REFSEQ:
NP_418523
SMR:
P16687
UNIPROT:
P16687


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Metcalf WW., Wanner BL., 1993, Mutational analysis of an Escherichia coli fourteen-gene operon for phosphonate degradation, using TnphoA' elements., J Bacteriol 175(11):3430-42


RegulonDB