RegulonDB RegulonDB 10.9: Gene Form
   

phnN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phnM phnP phnL phnN phnO

Gene      
Name: phnN    Texpresso search in the literature
Synonym(s): ECK4087, EG10723, b4094
Genome position(nucleotides): 4315525 <-- 4316082 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
60.22
External database links:  
ASAP:
ABE-0013417
CGSC:
34523
ECHOBASE:
EB0717
ECOLIHUB:
phnN
OU-MICROARRAY:
b4094
STRING:
511145.b4094
COLOMBOS: phnN


Product      
Name: ribose 1,5-bisphosphate phosphokinase
Synonym(s): PhnN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 20.73
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence
6 -> 139 IWLMGPSGSGKDSLLAELRLREQTQLLVAHRYITRDASAGSENHIALSEQEFFTRAGQNLLALSWHANGLYYGVGVEIDLWLHAGFDVLVNGSRAHLPQARARYQSALLPVCLQVSPEILRQRLENRGRENASE
10 -> 17 GPSGSGKD

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.8 - metabolism of other compounds --> 1.8.1 - phosphorous metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0033863 - ribose 1,5-bisphosphate phosphokinase activity
biological_process GO:0009435 - NAD biosynthetic process
GO:0019634 - organic phosphonate metabolic process
GO:0046835 - carbohydrate phosphorylation
GO:0006015 - 5-phosphoribose 1-diphosphate biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Hove-Jensen B., et al., 2011
External database links:  
ECOCYC:
EG10723-MONOMER
ECOLIWIKI:
b4094
INTERPRO:
IPR027417
INTERPRO:
IPR012699
INTERPRO:
IPR008145
MODBASE:
P16690
PFAM:
PF13238
PRIDE:
P16690
PRODB:
PRO_000023538
REFSEQ:
NP_418518
SMART:
SM00072
SMR:
P16690
UNIPROT:
P16690


Operon      
Name: phnCDEFGHIJKLMNOP         
Operon arrangement:
Transcription unit        Promoter
phnCDEEFGHIJKLMNOP
phnLMNOP


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Hove-Jensen B., McSorley FR., Zechel DL., 2011, Physiological role of phnP-specified phosphoribosyl cyclic phosphodiesterase in catabolism of organophosphonic acids by the carbon-phosphorus lyase pathway., J Am Chem Soc 133(10):3617-24


RegulonDB