RegulonDB RegulonDB 10.8: Gene Form
   

phoE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proB phoE insA9 insB9 PhoB PhoB PhoB TSS_464 TSS_464 TSS_463 TSS_463 TSS_462 TSS_462 TSS_461 TSS_461 TSS_460 (cluster) TSS_460 (cluster) TSS_459 TSS_459 TSS_458 TSS_458 TSS_457 (cluster) TSS_457 (cluster) proBp11 proBp11 proBp8 proBp8 phoEp phoEp

Gene      
Name: phoE    Texpresso search in the literature
Synonym(s): ECK0242, EG10729, b0241, ompE
Genome position(nucleotides): 259045 <-- 260100 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.7
External database links:  
ASAP:
ABE-0000823
CGSC:
396
ECHOBASE:
EB0722
OU-MICROARRAY:
b0241
PortEco:
phoE
STRING:
511145.b0241
COLOMBOS: phoE


Shine dalgarno      
Sequence: taattaaaatCAGGAAtgaaAAT


Product      
Name: outer membrane porin PhoE
Synonym(s): OmpE, PhoE, outer membrane phosphoporin, outer membrane pore protein E (E,Ic,NmpAB)
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane
Molecular weight: 38.922
Isoelectric point: 4.711
Motif(s):
 
Type Positions Sequence
1 -> 21 MKKSTLALVVMGIVASASVQA
22 -> 351 AEIYNKDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF
27 -> 351 KDGNKLDVYGKVKAMHYMSDNASKDGDQSYIRFGFKGETQINDQLTGYGRWEAEFAGNKAESDTAQQKTRLAFAGLKYKDLGSFDYGRNLGALYDVEAWTDMFPEFGGDSSAQTDNFMTKRASGLATYRNTDFFGVIDGLNLTLQYQGKNENRDVKKQNGDGFGTSLTYDFGGSDFAISGAYTNSDRTNEQNLQSRGTGKRAEAWATGLKYDANNIYLATFYSETRKMTPITGGFANKTQNFEAVAQYQFDFGLRPSLGYVLSKGKDIEGIGDEDLVNYIDVGATYYFNKNMSAFVDYKINQLDSDNKLNINNDDIVAVGMTYQF
351 -> 351 F

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.1 - Channel-type Transporters --> 4.1.B - Beta barrel porins (The Outer Membrane Porin (OMP) Functional Superfamily)
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0016021 - integral component of membrane
GO:0046930 - pore complex
molecular_function GO:0015288 - porin activity
biological_process GO:0006811 - ion transport
GO:0034220 - ion transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10498N
ECOCYC:
MONOMER0-282
ECOLIWIKI:
b0241
INTERPRO:
IPR023614
INTERPRO:
IPR033900
INTERPRO:
IPR013793
INTERPRO:
IPR001897
INTERPRO:
IPR001702
MINT:
MINT-1285942
MODBASE:
P02932
PDB:
1PHO
PFAM:
PF00267
PRIDE:
P02932
PRINTS:
PR00182
PRINTS:
PR00183
PRODB:
PRO_000023542
PROSITE:
PS00576
REFSEQ:
NP_414776
SMR:
P02932
UNIPROT:
P02932


Operon      
Name: phoE         
Operon arrangement:
Transcription unit        Promoter
phoE


Transcriptional Regulation      
Display Regulation             
Activated by: PhoB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter proBp8 260216 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter proBp11 260303 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_457 (cluster) 260345 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_458 260354 forward nd [RS-EPT-CBR] [2]
  promoter TSS_459 260358 forward nd [RS-EPT-CBR] [2]
  promoter TSS_460 (cluster) 260360 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_461 260370 forward nd [RS-EPT-CBR] [2]
  promoter TSS_462 260569 forward nd [RS-EPT-CBR] [2]
  promoter TSS_463 261229 forward nd [RS-EPT-CBR] [2]
  promoter TSS_464 261423 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB