RegulonDB RegulonDB 10.8: Gene Form
   

creC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

creC creD creB creA CreB terminator creDp creDp

Gene      
Name: creC    Texpresso search in the literature
Synonym(s): ECK4391, EG10730, b4399, phoM
Genome position(nucleotides): 4636696 --> 4638120 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.89
Reference(s): [1] Amemura M., et al., 1986
External database links:  
ASAP:
ABE-0014430
CGSC:
395
ECHOBASE:
EB0723
OU-MICROARRAY:
b4399
PortEco:
creC
STRING:
511145.b4399
COLOMBOS: creC


Shine dalgarno      
Sequence: ggatatagccTGAGGGgcctgtaATG


Product      
Name: sensory histidine kinase CreC
Synonym(s): CreC, PhoM
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 52.176
Isoelectric point: 9.502
Motif(s):
 
Type Positions Sequence
77 -> 77 R
205 -> 255 WINRSIARLTRYADSVTDNKPVPLPDLGSSELRKLAQALESMRVKLEGKNY
7 -> 27 LLLGYFLLVAVAAWFVLAIFV
202 -> 251 MVWWINRSIARLTRYADSVTDNKPVPLPDLGSSELRKLAQALESMRVKLE
259 -> 319 YVYALTHELKSPLAAIRGAAEILREGPPPEVVARFTDNILTQNARMQALVETLLRQARLEN

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
biological_process GO:0016310 - phosphorylation
GO:0047484 - regulation of response to osmotic stress
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0019660 - glycolytic fermentation
External database links:  
DIP:
DIP-9319N
ECOCYC:
CREC-MONOMER
ECOLIWIKI:
b4399
INTERPRO:
IPR005467
INTERPRO:
IPR036890
INTERPRO:
IPR036097
INTERPRO:
IPR029151
INTERPRO:
IPR004358
INTERPRO:
IPR003661
INTERPRO:
IPR003660
INTERPRO:
IPR003594
MINT:
MINT-1307740
MODBASE:
P08401
PFAM:
PF00672
PFAM:
PF02518
PFAM:
PF00512
PRIDE:
P08401
PRINTS:
PR00344
PRODB:
PRO_000022330
PROSITE:
PS50885
PROSITE:
PS50109
REFSEQ:
NP_418816
SMART:
SM00304
SMART:
SM00388
SMART:
SM00387
SMR:
P08401
UNIPROT:
P08401


Operon      
Name: creABCD         
Operon arrangement:
Transcription unit        Promoter
creABC
creABCD
creD


Transcriptional Regulation      
Display Regulation             
Repressed by: NagC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References


Reference(s)    

 [1] Amemura M., Makino K., Shinagawa H., Nakata A., 1986, Nucleotide sequence of the phoM region of Escherichia coli: four open reading frames may constitute an operon., J Bacteriol 168(1):294-302


RegulonDB