RegulonDB RegulonDB 10.9: Gene Form
   

phoQ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

phoQ purB roxA phoP PurR PhoP terminator phoPp2 phoPp2 phoPp3 phoPp3 phoPp1 phoPp1 TSS_1474 (cluster) TSS_1474 (cluster) TSS_1473 TSS_1473 TSS_1472 TSS_1472 TSS_1471 TSS_1471 TSS_1470 TSS_1470 phoQp5 phoQp5 TSS_1469 TSS_1469 TSS_1468 TSS_1468 ycfDp5 ycfDp5 ycfDp4 ycfDp4 TSS_1466 (cluster) TSS_1466 (cluster)

Gene      
Name: phoQ    Texpresso search in the literature
Synonym(s): ECK1115, EG10732, b1129
Genome position(nucleotides): 1188316 <-- 1189776 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.33
External database links:  
ASAP:
ABE-0003805
CGSC:
31922
ECHOBASE:
EB0725
ECOLIHUB:
phoQ
OU-MICROARRAY:
b1129
STRING:
511145.b1129
COLOMBOS: phoQ


Product      
Name: sensor histidine kinase PhoQ
Synonym(s): PhoQ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.3
Isoelectric point: 5.525
Motif(s):
 
Type Positions Sequence
202 -> 202 N
150 -> 150 D
151 -> 151 D
179 -> 179 D
10 -> 188 PLSLRVRFLLATAAVVLVLSLAYGMVALIGYSVSFDKTTFRLLRGESNLFYTLAKWENNKLHVELPENIDKQSPTMTLIYDENGQLLWAQRDVPWLMKMIQPDWLKSNGFHEIEADVNDTSLLLSGDHSIQQQLQEVREDDDDAEMTHSVAVNVYPATSRMPKLTIVVVDTIPVELKSS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.4 - complex regulation --> 3.1.2.4.3 - two component regulatory systems (external signal)
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.2 - covalent modification, demodification, maturation
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0004721 - phosphoprotein phosphatase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0000155 - phosphorelay sensor kinase activity
GO:0004673 - protein histidine kinase activity
GO:0042802 - identical protein binding
biological_process GO:0006470 - protein dephosphorylation
GO:0016310 - phosphorylation
GO:0000160 - phosphorelay signal transduction system
GO:0007165 - signal transduction
GO:0007234 - osmosensory signaling via phosphorelay pathway
GO:0046777 - protein autophosphorylation
GO:0018106 - peptidyl-histidine phosphorylation
GO:0010350 - cellular response to magnesium starvation
GO:0023014 - signal transduction by protein phosphorylation
External database links:  
DIP:
DIP-10501N
ECOCYC:
PHOQ-MONOMER
ECOLIWIKI:
b1129
INTERPRO:
IPR004358
INTERPRO:
IPR015014
INTERPRO:
IPR003660
INTERPRO:
IPR036097
INTERPRO:
IPR005467
INTERPRO:
IPR038429
INTERPRO:
IPR036890
INTERPRO:
IPR003594
MODBASE:
P23837
PDB:
6A8V
PDB:
6A8U
PDB:
3BQA
PDB:
3BQ8
PDB:
1ID0
PFAM:
PF08918
PFAM:
PF02518
PRIDE:
P23837
PRINTS:
PR00344
PRODB:
PRO_000023545
PROSITE:
PS50885
PROSITE:
PS50109
REFSEQ:
NP_415647
SMART:
SM00387
SMR:
P23837
SWISSMODEL:
P23837
UNIPROT:
P23837


Operon      
Name: phoPQ         
Operon arrangement:
Transcription unit        Promoter
phoQ
phoPQ
phoPQ
phoPQ


Transcriptional Regulation      
Display Regulation             
Activated by: PhoP, PhoB
Repressed by: PhoP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1466 (cluster) 1188265 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter ycfDp4 1188267 reverse Similarity to the consensus
Read more >
[ICWHO], [RS-EPT-CBR] [1], [2]
  promoter ycfDp5 1188270 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1468 1189078 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1469 1189096 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1470 1189968 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1471 1190330 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1472 1190342 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1473 1190470 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1474 (cluster) 1190474 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB