RegulonDB RegulonDB 10.7: Gene Form
   

pncB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pepN asnS pncB CRP CRP NadR anti-anti-terminator anti-terminator terminator TSS_1246 TSS_1246 TSS_1245 (cluster) TSS_1245 (cluster) pepNp pepNp TSS_1243 TSS_1243 pncBp pncBp TSS_1241 TSS_1241 asnSp asnSp TSS_1239 (cluster) TSS_1239 (cluster) TSS_1238 TSS_1238 TSS_1237 (cluster) TSS_1237 (cluster) TSS_1236 TSS_1236 TSS_1235 TSS_1235 TSS_1234 TSS_1234 TSS_1233 TSS_1233 TSS_1232 TSS_1232 TSS_1231 TSS_1231

Gene      
Name: pncB    Texpresso search in the literature
Synonym(s): ECK0922, EG10742, b0931
Genome position(nucleotides): 989154 <-- 990356 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.21
External database links:  
ASAP:
ABE-0003167
CGSC:
380
ECHOBASE:
EB0735
OU-MICROARRAY:
b0931
PORTECO:
pncB
REGULONDB:
b0931
STRING:
511145.b0931
M3D: pncB
COLOMBOS: pncB
PortEco: b0931


Product      
Name: nicotinate phosphoribosyltransferase
Synonym(s): PncB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 45.897
Isoelectric point: 6.678
Motif(s):
 
Type Positions Sequence
169 -> 394 FHLMDFGTRRRFSREVQETIVKRLQQESWFVGTSNYDLARRLSLTPMGTQAHEWFQAHQQISPDLANSQRAALAAWLEEYPDQLGIALTDCITMDAFLRDFGVEFASRYQGLRHDSGDPVEWGEKAIAHYEKLGIDPQSKTLVFSDNLDLRKAVELYRHFSSRVQLSFGIGTRLTCDIPQVKPLNIVIKLVECNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLP
13 -> 130 LDTDAYKLHMQQAVFHHYYDVHVAAEFRCRGDDLLGIYADAIREQVQAMQHLRLQDDEYQWLSALPFFKADYLNWLREFRFNPEQVTVSNDNGKLDIRLSGPWREVILWEVPLLAVIS
2 -> 400 TQFASPVLHSLLDTDAYKLHMQQAVFHHYYDVHVAAEFRCRGDDLLGIYADAIREQVQAMQHLRLQDDEYQWLSALPFFKADYLNWLREFRFNPEQVTVSNDNGKLDIRLSGPWREVILWEVPLLAVISEMVHRYRSPQADVAQALDTLESKLVDFSALTAGLDMSRFHLMDFGTRRRFSREVQETIVKRLQQESWFVGTSNYDLARRLSLTPMGTQAHEWFQAHQQISPDLANSQRAALAAWLEEYPDQLGIALTDCITMDAFLRDFGVEFASRYQGLRHDSGDPVEWGEKAIAHYEKLGIDPQSKTLVFSDNLDLRKAVELYRHFSSRVQLSFGIGTRLTCDIPQVKPLNIVIKLVECNGKPVAKLSDSPGKTICHDKAFVRALRKAFDLPHIKKAS

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.3 - cofactors, small molecule carriers --> 1.5.3.7 - nicotinamide adenine dinucleotide
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016874 - ligase activity
GO:0016879 - ligase activity, forming carbon-nitrogen bonds
GO:0004514 - nicotinate-nucleotide diphosphorylase (carboxylating) activity
GO:0004516 - nicotinate phosphoribosyltransferase activity
biological_process GO:0009408 - response to heat
GO:0009435 - NAD biosynthetic process
GO:0019363 - pyridine nucleotide biosynthetic process
GO:0034355 - NAD salvage
Note(s): Note(s): ...[more].
Reference(s): [1] Andreoli AJ., et al., 1969
External database links:  
DIP:
DIP-10521N
ECOCYC:
NICOTINATEPRIBOSYLTRANS-MONOMER
ECOLIWIKI:
b0931
INTERPRO:
IPR040727
INTERPRO:
IPR041525
INTERPRO:
IPR006406
INTERPRO:
IPR007229
INTERPRO:
IPR036068
MINT:
MINT-1246310
MODBASE:
P18133
PANTHER:
PTHR11098
PFAM:
PF04095
PFAM:
PF17767
PRIDE:
P18133
PROTEINMODELPORTAL:
P18133
REFSEQ:
NP_415451
SMR:
P18133
SWISSMODEL:
P18133
UNIPROT:
P18133


Operon      
Name: pncB         
Operon arrangement:
Transcription unit        Promoter
pncB


Transcriptional Regulation      
Display Regulation             
Repressed by: CRP, NadR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1231 988306 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1232 988310 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1233 988988 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1234 988990 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1235 988995 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1236 988999 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1237 (cluster) 989003 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1238 989005 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1239 (cluster) 989020 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1241 989614 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_1243 990515 forward nd [RS-EPT-CBR] [2]
  promoter TSS_1245 (cluster) 991200 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_1246 991492 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Andreoli AJ., Grover T., Gholson RK., Matney TS., 1969, Evidence for a functional pyridine nucleotide cycle in Escherichia coli., Biochim Biophys Acta 192(3):539-41

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB