RegulonDB RegulonDB 10.8: Gene Form
   

pntA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pntA pntB ydgH terminator anti-terminator ydgHp5 ydgHp5 TSS_1893 TSS_1893 TSS_1892 TSS_1892 TSS_1891 TSS_1891 TSS_1890 TSS_1890 pntAp pntAp TSS_1889 TSS_1889 TSS_1888 TSS_1888 pntBp6 pntBp6 TSS_1887 TSS_1887 TSS_1886 TSS_1886 TSS_1885 TSS_1885 TSS_1884 (cluster) TSS_1884 (cluster) TSS_1883 TSS_1883

Gene      
Name: pntA    Texpresso search in the literature
Synonym(s): ECK1598, EG10744, b1603
Genome position(nucleotides): 1676371 <-- 1677903 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.45
External database links:  
ASAP:
ABE-0005354
CGSC:
18043
ECHOBASE:
EB0737
MIM:
614736
OU-MICROARRAY:
b1603
PortEco:
pntA
STRING:
511145.b1603
COLOMBOS: pntA


Shine dalgarno      
Sequence: aaaccgatggAAGGGAatatCAT


Product      
Name: pyridine nucleotide transhydrogenase subunit α
Synonym(s): PntA
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 54.623
Isoelectric point: 5.563
Motif(s):
 
Type Positions Sequence
4 -> 137 GIPRERLTNETRVAATPKTVEQLLKLGFTVAVESGAGQLASFDDKAFVQAGAEIVEGNSVWQSEIILKVNAPLDDEIALLNPGTTLVSFIWPAQNPELMQKLAERNVTVMAMDSVPRISRAQSLDALSSMANIA
120 -> 122 RIS
141 -> 368 AIVEAAHEFGRFFTGQITAAGKVPPAKVMVIGAGVAGLAAIGAANSLGAIVRAFDTRPEVKEQVQSMGAEFLELDFKEEAGSGDGYAKVMSDAFIKAEMELFAAQAKEVDIIVTTALIPGKPAPKLITREMVDSMKAGSVIVDLAAQNGGNCEYTVPGEIFTTENGVKVIGYTDLPGRLPTQSSQLYGTNLVNLLKLLCKEKDGNITVDFDDVVIRGVTVIRAGEITW
477 -> 497 WVSFLSFIAVLIASINIFGGF
151 -> 161 RFFTGQITAAG

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0000166 - nucleotide binding
GO:0008746 - NAD(P)+ transhydrogenase activity
GO:0008750 - NAD(P)+ transhydrogenase (AB-specific) activity
GO:0046983 - protein dimerization activity
GO:0050661 - NADP binding
GO:0051287 - NAD binding
biological_process GO:0006740 - NADPH regeneration
GO:0055114 - oxidation-reduction process
GO:1902600 - proton transmembrane transport
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-366N
ECOCYC:
PNTA-MONOMER
ECOLIWIKI:
b1603
INTERPRO:
IPR036291
INTERPRO:
IPR026255
INTERPRO:
IPR024605
INTERPRO:
IPR008143
INTERPRO:
IPR008142
INTERPRO:
IPR007886
INTERPRO:
IPR007698
MINT:
MINT-1299705
MODBASE:
P07001
PDB:
1X15
PDB:
2BRU
PDB:
1X14
PDB:
1X13
PFAM:
PF01262
PFAM:
PF05222
PFAM:
PF12769
PRIDE:
P07001
PRODB:
PRO_000023562
PROSITE:
PS00836
PROSITE:
PS00837
REFSEQ:
NP_416120
SMART:
SM01003
SMART:
SM01002
SMR:
P07001
UNIPROT:
P07001


Operon      
Name: pntAB         
Operon arrangement:
Transcription unit        Promoter
pntAB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_1883 1675550 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1884 (cluster) 1676197 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_1885 1676203 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1886 1676256 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1887 1676312 reverse nd [RS-EPT-CBR] [1]
  promoter pntBp6 1676548 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1888 1676849 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1889 1677293 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1890 1678014 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_1891 1678308 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1892 1678368 forward nd [RS-EPT-CBR] [1]
  promoter TSS_1893 1678370 forward nd [RS-EPT-CBR] [1]
  promoter ydgHp5 1678377 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB