RegulonDB RegulonDB 10.6.3: Gene Form
   

polA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

polA yihG spf CRP DnaA terminator spfp spfp TSS_4538 TSS_4538 TSS_4537 TSS_4537 TSS_4536 TSS_4536 TSS_4535 TSS_4535 TSS_4534 TSS_4534 polAp polAp TSS_4533 TSS_4533 yihGp yihGp

Gene      
Name: polA    Texpresso search in the literature
Synonym(s): ECK3855, EG10746, b3863, resA
Genome position(nucleotides): 4046966 --> 4049752 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.96
External database links:  
ASAP:
ABE-0012618
CGSC:
375
ECHOBASE:
EB0739
ECOCYC:
EG10746
ECOLIHUB:
polA
OU-MICROARRAY:
b3863
REGULONDB:
b3863
STRING:
511145.b3863
M3D: polA
COLOMBOS: polA
PortEco: b3863


Shine dalgarno      
Sequence: gataaacaggCACGGAcattATG


Product      
Name: DNA polymerase I
Synonym(s): DNA polymerase I, 5' --> 3' polymerase, 5' --> 3' and 3' --> 5' exonuclease, PolA, ResA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 103.118
Isoelectric point: 5.27
Motif(s):
 
Type Positions Sequence
330 -> 516 YVTILDEETLKAWIAKLEKAPVFAFDTETDSLDNISANLVGLSFAIEPGVAAYIPVAHDYLDAPDQISRERALELLKPLLEDEKALKVGQNLKYDRGILANYGIELRGIAFDTMLESYILNSVAGRHDMDSLAERWLKHKTITFEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWPDL
521 -> 928 GPLNVFENIEMPLVPVLSRIERNGVKIDPKVLHNHSEELTLRLAELEKKAHEIAGEEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGARRAAAERAAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDVPLLVEVGSGENWDQAH
552 -> 925 LHNHSEELTLRLAELEKKAHEIAGEEFNLSSTKQLQTILFEKQGIKPLKKTPGGAPSTSEEVLEELALDYPLPKVILEYRGLAKLKSTYTDKLPLMINPKTGRVHTSYHQAVTATGRLSSTDPNLQNIPVRNEEGRRIRQAFIAPEDYVIVSADYSQIELRIMAHLSRDKGLLTAFAEGKDIHRATAAEVFGLPLETVTSEQRRSAKAINFGLIYGMSAFGLARQLNIPRKEAQKYMDLYFERYPGVLEYMERTRAQAKEQGYVETLDGRRLYLPDIKSSNGARRAAAERAAINAPMQGTAADIIKRAMIAVDAWLQAEQPRVRMIMQVHDELVFEVHKDDVDAVAKQIHQLMENCTRLDVPLLVEVGSGENWD
9 -> 170 LILVDGSSYLYRAYHAFPPLTNSAGEPTGAMYGVLNMLRSLIMQYKPTHAAVVFDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGLPLLAVSGVEADDVIGTLAREAEKAGRPVLISTGDKDMAQLVTPNITLINTMTNTILGPEEVVNKYG
1 -> 323 MVQIPQNPLILVDGSSYLYRAYHAFPPLTNSAGEPTGAMYGVLNMLRSLIMQYKPTHAAVVFDAKGKTFRDELFEHYKSHRPPMPDDLRAQIEPLHAMVKAMGLPLLAVSGVEADDVIGTLAREAEKAGRPVLISTGDKDMAQLVTPNITLINTMTNTILGPEEVVNKYGVPPELIIDFLALMGDSSDNIPGVPGVGEKTAQALLQGLGGLDTLYAEPEKIAGLSFRGAKTMAAKLEQNKEVAYLSYQLATIKTDVELELTCEQLEVQQPAAEELLGLFKKYEFKRWTADVEAGKWLQAKGAKPAAKPQETSVADEAPEVTAT

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0003677 - DNA binding
GO:0003824 - catalytic activity
GO:0003887 - DNA-directed DNA polymerase activity
GO:0016779 - nucleotidyltransferase activity
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0016787 - hydrolase activity
GO:0008408 - 3'-5' exonuclease activity
GO:0016740 - transferase activity
GO:0008409 - 5'-3' exonuclease activity
biological_process GO:0006139 - nucleobase-containing compound metabolic process
GO:0006260 - DNA replication
GO:0006261 - DNA-dependent DNA replication
GO:0006281 - DNA repair
GO:0006974 - cellular response to DNA damage stimulus
GO:0006284 - base-excision repair
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0071897 - DNA biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Bailey MF., et al., 2004
External database links:  
DIP:
DIP-10524N
ECOCYC:
EG10746-MONOMER
ECOLIWIKI:
b3863
INTERPRO:
IPR036397
INTERPRO:
IPR018320
INTERPRO:
IPR012337
INTERPRO:
IPR019760
INTERPRO:
IPR036279
INTERPRO:
IPR029060
INTERPRO:
IPR020046
INTERPRO:
IPR020045
INTERPRO:
IPR001098
INTERPRO:
IPR002298
INTERPRO:
IPR002421
INTERPRO:
IPR002562
INTERPRO:
IPR008918
MINT:
MINT-1225247
MODBASE:
P00582
PANTHER:
PTHR10133
PDB:
1KSP
PDB:
1QSL
PDB:
2KFN
PDB:
2KFZ
PDB:
1KFS
PDB:
2KZZ
PDB:
2KZM
PDB:
1KFD
PDB:
1DPI
PDB:
1D9F
PDB:
1D9D
PDB:
1KRP
PDB:
1KLN
PDB:
1D8Y
PFAM:
PF02739
PFAM:
PF01612
PFAM:
PF01367
PFAM:
PF00476
PRIDE:
P00582
PRINTS:
PR00868
PRODB:
PRO_000023565
PROSITE:
PS00447
PROTEINMODELPORTAL:
P00582
REFSEQ:
NP_418300
SMART:
SM00279
SMART:
SM00474
SMART:
SM00482
SMART:
SM00475
SMR:
P00582
UNIPROT:
P00582


Operon      
Name: polA         
Operon arrangement:
Transcription unit        Promoter
polA


Transcriptional Regulation      
Display Regulation             
Activated by: DnaA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4533 4046939 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4534 4047199 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4535 4048629 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4536 4048749 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4537 4049298 forward nd [RS-EPT-CBR] [2]
  promoter TSS_4538 4049325 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bailey MF., van der Schans EJ., Millar DP., 2004, Thermodynamic dissection of the polymerizing and editing modes of a DNA polymerase., J Mol Biol 336(3):673-93

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Mu¿¿iz-Rascado L, Garc¿¿a-Sotelo JS, Weiss V, Solano-Lira H, Mart¿¿nez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hern¿¿ndez S, Alquicira-Hern¿¿ndez K, L¿¿pez-Fuentes A, Porr¿¿n-Sotelo L, Huerta AM, Bonavides-Mart¿¿nez C, Balderas-Mart¿¿nez YI, Pannier L, Olvera M, Labastida A, Jim¿¿nez-Jacinto V, Vega-Alvarado L, Del Moral-Ch¿¿vez V, Hern¿¿ndez-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB