RegulonDB RegulonDB 10.9: Gene Form
   

ppiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

Gene      
Name: ppiA    Texpresso search in the literature
Synonym(s): ECK3351, EG10757, b3363, rot, rotA
Genome position(nucleotides): 3491725 <-- 3492297 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.13
External database links:  
ASAP:
ABE-0010992
CGSC:
31121
ECHOBASE:
EB0750
ECOLIHUB:
ppiA
OU-MICROARRAY:
b3363
STRING:
511145.b3363
COLOMBOS: ppiA


Product      
Name: peptidyl-prolyl cis-trans isomerase A
Synonym(s): PpiA, Rot, RotA, rotamase A
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 20.431
Isoelectric point: 9.385
Motif(s):
 
Type Positions Sequence
1 -> 24 MFKSTLAAMAAVFALSALSPAAMA
27 -> 188 GDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKV
136 -> 136 F
25 -> 190 AKGDPHVLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKVLP
31 -> 188 VLLTTSAGNIELELDKQKAPVSVQNFVDYVNSGFYNNTTFHRVIPGFMIQGGGFTEQMQQKKPNPPIKNEADNGLRNTRGTIAMARTADKDSATSQFFINVADNAFLDHGQRDFGYAVFGKVVKGMDVADKISQVPTHDVGPYQNVPSKPVVILSAKV

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
biological_process GO:0006457 - protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48080N
ECOCYC:
EG10757-MONOMER
ECOLIWIKI:
b3363
INTERPRO:
IPR002130
INTERPRO:
IPR029000
INTERPRO:
IPR020892
MODBASE:
P0AFL3
PDB:
1J2A
PDB:
1V9T
PDB:
1VAI
PDB:
1CLH
PFAM:
PF00160
PRIDE:
P0AFL3
PRINTS:
PR00153
PROSITE:
PS50072
PROSITE:
PS00170
REFSEQ:
NP_417822
SMR:
P0AFL3
SWISSMODEL:
P0AFL3
UNIPROT:
P0AFL3


Operon      
Name: ppiA         
Operon arrangement:
Transcription unit        Promoter
ppiA
ppiA
ppiA
ppiA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, CpxR
Repressed by: CRP, CytR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB