RegulonDB RegulonDB 10.8: Gene Form
   

ppiB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysS lpxH ppiB cysSp cysSp TSS_678 TSS_678 TSS_677 (cluster) TSS_677 (cluster) TSS_676 TSS_676 TSS_675 TSS_675 TSS_674 (cluster) TSS_674 (cluster)

Gene      
Name: ppiB    Texpresso search in the literature
Synonym(s): ECK0518, EG10758, b0525
Genome position(nucleotides): 553943 <-- 554437 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.88
External database links:  
ASAP:
ABE-0001806
CGSC:
31117
ECHOBASE:
EB0751
OU-MICROARRAY:
b0525
PortEco:
ppiB
STRING:
511145.b0525
COLOMBOS: ppiB


Product      
Name: peptidyl-prolyl cis-trans isomerase B
Synonym(s): PpiB, rotamase B
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.153
Isoelectric point: 5.588
Motif(s):
 
Type Positions Sequence
1 -> 162 MVTFHTNHGDIVIKTFDDKAPETVKNFLDYCREGFYNNTIFHRVINGFMIQGGGFEPGMKQKATKEPIKNEANNGLKNTRGTLAMARTQAPHSATAQFFINVVDNDFLNFSGESLQGWGYCVFAEVVDGMDVVDKIKGVATGRSGMHQDVPKEDVIIESVTV
132 -> 132 V

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.4 - chaperoning, repair (refolding)
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0003755 - peptidyl-prolyl cis-trans isomerase activity
biological_process GO:0006457 - protein folding
GO:0000413 - protein peptidyl-prolyl isomerization
Note(s): Note(s): ...[more].
Reference(s): [1] Guignard L., et al., 2002
[2] Rodriguez-Moya M., et al., 2015
External database links:  
DIP:
DIP-10546N
ECOCYC:
EG10758-MONOMER
ECOLIWIKI:
b0525
INTERPRO:
IPR002130
INTERPRO:
IPR029000
INTERPRO:
IPR024936
INTERPRO:
IPR020892
MINT:
MINT-1289871
MODBASE:
P23869
PANTHER:
PTHR11071
PDB:
2RS4
PDB:
1LOP
PDB:
2NUL
PFAM:
PF00160
PRIDE:
P23869
PRINTS:
PR00153
PROSITE:
PS50072
PROSITE:
PS00170
REFSEQ:
NP_415058
SMR:
P23869
UNIPROT:
P23869


Operon      
Name: ppiB-lpxH         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_674 (cluster) 554360 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_675 554367 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_676 554460 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_677 (cluster) 554490 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_678 554492 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Guignard L., Ozawa K., Pursglove SE., Otting G., Dixon NE., 2002, NMR analysis of in vitro-synthesized proteins without purification: a high-throughput approach., FEBS Lett 524(1-3):159-62

 [2] Rodriguez-Moya M., Gonzalez R., 2015, Proteomic analysis of the response of Escherichia coli to short-chain fatty acids., J Proteomics 122:86-99

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB