RegulonDB RegulonDB 10.9: Gene Form
   

ppsA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ppsA fadK ppsR TrpR Cra terminator anti-terminator anti-anti-terminator TSS_1991 TSS_1991 ppsRp6 ppsRp6 ppsRp8 ppsRp8 ppsRp1 ppsRp1 ppsp ppsp

Gene      
Name: ppsA    Texpresso search in the literature
Synonym(s): ECK1700, EG10759, b1702, pps
Genome position(nucleotides): 1784734 <-- 1787112 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.64
External database links:  
ASAP:
ABE-0005678
CGSC:
367
ECHOBASE:
EB0752
ECOLIHUB:
ppsA
ECOO157CYC:
PPSA
OU-MICROARRAY:
b1702
STRING:
511145.b1702
COLOMBOS: ppsA


Product      
Name: phosphoenolpyruvate synthetase
Synonym(s): Pps, PpsA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 87.435
Isoelectric point: 4.685
Motif(s):
 
Type Positions Sequence
194 -> 195 RM
386 -> 457 IEPGDVLVTDMTDPDWEPIMKKASAIVTNRGGRTCHAAIIARELGIPAVVGCGDATERMKDGENVTVSCAEG
22 -> 350 DRVGGKNASLGEMITNLSGMGVSVPNGFATTADAFNQFLDQSGVNQRIYELLDKTDIDDVTQLAKAGAQIRQWIIDTPFQPELENAIREAYAQLSADDENASFAVRSSATAEDMPDASFAGQQETFLNVQGFDAVLVAVKHVFASLFNDRAISYRVHQGYDHRGVALSAGVQRMVRSDLASSGVMFSIDTESGFDQVVFITSAWGLGEMVVQGAVNPDEFYVHKPTLAANRPAIVRRTMGSKKIRMVYAPTQEHGKQVKIEDVPQEQRDIFSLTNEEVQELAKQAVQIEKHYGRPMDIEWAKDGHTGKLFIVQARPETVRSRGQVMERY
481 -> 789 DLPLKVMMNVGNPDRAFDFACLPNEGVGLARLEFIINRMIGVHPRALLEFDDQEPQLQNEIREMMKGFDSPREFYVGRLTEGIATLGAAFYPKRVIVRLSDFKSNEYANLVGGERYEPDEENPMLGFRGAGRYVSDSFRDCFALECEAVKRVRNDMGLTNVEIMIPFVRTVDQAKAVVEELARQGLKRGENGLKIIMMCEIPSNALLAEQFLEYFDGFSIGSNDMTQLALGLDRDSGVVSELFDERNDAVKALLSMAIRAAKKQGKYVGICGQGPSDHEDFAAWLMEEGIDSLSLNPDTVVQTWLSLAE
2 -> 792 SNNGSSPLVLWYNQLGMNDVDRVGGKNASLGEMITNLSGMGVSVPNGFATTADAFNQFLDQSGVNQRIYELLDKTDIDDVTQLAKAGAQIRQWIIDTPFQPELENAIREAYAQLSADDENASFAVRSSATAEDMPDASFAGQQETFLNVQGFDAVLVAVKHVFASLFNDRAISYRVHQGYDHRGVALSAGVQRMVRSDLASSGVMFSIDTESGFDQVVFITSAWGLGEMVVQGAVNPDEFYVHKPTLAANRPAIVRRTMGSKKIRMVYAPTQEHGKQVKIEDVPQEQRDIFSLTNEEVQELAKQAVQIEKHYGRPMDIEWAKDGHTGKLFIVQARPETVRSRGQVMERYTLHSQGKIIAEGRAIGHRIGAGPVKVIHDISEMNRIEPGDVLVTDMTDPDWEPIMKKASAIVTNRGGRTCHAAIIARELGIPAVVGCGDATERMKDGENVTVSCAEGDTGYVYAELLEFSVKSSSVETMPDLPLKVMMNVGNPDRAFDFACLPNEGVGLARLEFIINRMIGVHPRALLEFDDQEPQLQNEIREMMKGFDSPREFYVGRLTEGIATLGAAFYPKRVIVRLSDFKSNEYANLVGGERYEPDEENPMLGFRGAGRYVSDSFRDCFALECEAVKRVRNDMGLTNVEIMIPFVRTVDQAKAVVEELARQGLKRGENGLKIIMMCEIPSNALLAEQFLEYFDGFSIGSNDMTQLALGLDRDSGVVSELFDERNDAVKALLSMAIRAAKKQGKYVGICGQGPSDHEDFAAWLMEEGIDSLSLNPDTVVQTWLSLAELKK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0046872 - metal ion binding
GO:0016301 - kinase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008986 - pyruvate, water dikinase activity
GO:0000287 - magnesium ion binding
GO:0042803 - protein homodimerization activity
biological_process GO:0006090 - pyruvate metabolic process
GO:0006094 - gluconeogenesis
GO:0016310 - phosphorylation
External database links:  
DIP:
DIP-10552N
ECOCYC:
PEPSYNTH-MONOMER
ECOLIWIKI:
b1702
INTERPRO:
IPR036637
INTERPRO:
IPR040442
INTERPRO:
IPR023151
INTERPRO:
IPR018274
INTERPRO:
IPR000121
INTERPRO:
IPR002192
INTERPRO:
IPR006319
INTERPRO:
IPR008279
INTERPRO:
IPR013815
INTERPRO:
IPR015813
MODBASE:
P23538
PANTHER:
PTHR43030
PFAM:
PF01326
PFAM:
PF02896
PFAM:
PF00391
PRIDE:
P23538
PRODB:
PRO_000023582
PROSITE:
PS00742
PROSITE:
PS00370
REFSEQ:
NP_416217
SMR:
P23538
UNIPROT:
P23538


Operon      
Name: ppsA         
Operon arrangement:
Transcription unit        Promoter
pps


Transcriptional Regulation      
Display Regulation             
Activated by: Cra


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter ppsRp1 1787339 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ppsRp8 1787351 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter ppsRp6 1787383 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_1991 1787415 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB