RegulonDB RegulonDB 10.9: Gene Form
   

priB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rpsF priB rpsR TSS_5061 (cluster) TSS_5061 (cluster) TSS_5060 TSS_5060 TSS_5059 TSS_5059 TSS_5058 TSS_5058

Gene      
Name: priB    Texpresso search in the literature
Synonym(s): ECK4197, EG10764, b4201
Genome position(nucleotides): 4425520 --> 4425834 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.38
External database links:  
ASAP:
ABE-0013742
CGSC:
29153
ECHOBASE:
EB0757
ECOLIHUB:
priB
OU-MICROARRAY:
b4201
STRING:
511145.b4201
COLOMBOS: priB


Product      
Name: primosomal replication protein N
Synonym(s): PriB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 11.442
Isoelectric point: 8.375
Motif(s):
 
Type Positions Sequence
2 -> 101 TNRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLSKMVLHAEQIELID
3 -> 88 NRLVLSGTVCRAPLRKVSPSGIPHCQFVLEHRSVQEEAGFHRQAWCQMPVIVSGHENQAITHSITVGSRITVQGFISCHKAKNGLS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0030894 - replisome
GO:1990077 - primosome complex
GO:1990099 - pre-primosome complex
molecular_function GO:0003677 - DNA binding
GO:0003697 - single-stranded DNA binding
GO:0005515 - protein binding
GO:0042802 - identical protein binding
biological_process GO:0006260 - DNA replication
GO:0006270 - DNA replication initiation
GO:0006276 - plasmid maintenance
GO:0009314 - response to radiation
GO:0006269 - DNA replication, synthesis of RNA primer
Reference(s): [1] Allen GC., et al., 1991
[2] Sargentini NJ., et al., 2016
[3] Zavitz KH., et al., 1991
External database links:  
DIP:
DIP-10563N
ECOCYC:
EG10764-MONOMER
ECOLIWIKI:
b4201
INTERPRO:
IPR012340
INTERPRO:
IPR023646
INTERPRO:
IPR000424
MINT:
P07013
MODBASE:
P07013
PDB:
2CCZ
PDB:
1TXY
PDB:
1V1Q
PDB:
2PNH
PDB:
1WOC
PDB:
5WQV
PFAM:
PF00436
PRIDE:
P07013
PRODB:
PRO_000023592
PROSITE:
PS50935
REFSEQ:
NP_418622
SMR:
P07013
UNIPROT:
P07013


Operon      
Name: rpsF-priB-rpsR-rplI         
Operon arrangement:
Transcription unit        Promoter
rpsF-priB-rpsR-rplI


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5058 4425138 forward nd [RS-EPT-CBR] [4]
  promoter TSS_5059 4425715 forward nd [RS-EPT-CBR] [4]
  promoter TSS_5060 4425821 forward nd [RS-EPT-CBR] [4]
  promoter TSS_5061 (cluster) 4425912 forward For this promoter, there
Read more >
[RS-EPT-CBR] [4]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Allen GC., Kornberg A., 1991, The priB gene encoding the primosomal replication n protein of Escherichia coli., J Biol Chem 266(18):11610-3

 [2] Sargentini NJ., Gularte NP., Hudman DA., 2016, Screen for genes involved in radiation survival of Escherichia coli and construction of a reference database., Mutat Res 793-794:1-14

 [3] Zavitz KH., DiGate RJ., Marians KJ., 1991, The priB and priC replication proteins of Escherichia coli. Genes, DNA sequence, overexpression, and purification., J Biol Chem 266(21):13988-95

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB