RegulonDB RegulonDB 10.8: Gene Form
   

proB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

proA proB phoE PhoB PhoB PhoB TSS_464 TSS_464 TSS_463 TSS_463 TSS_462 TSS_462 TSS_461 TSS_461 TSS_460 (cluster) TSS_460 (cluster) TSS_459 TSS_459 TSS_458 TSS_458 TSS_457 (cluster) TSS_457 (cluster) proBp11 proBp11 proBp8 proBp8 phoEp phoEp

Gene      
Name: proB    Texpresso search in the literature
Synonym(s): ECK0243, EG10768, b0242, pro(2), pro2
Genome position(nucleotides): 260388 --> 261491 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.25
External database links:  
ASAP:
ABE-0000830
CGSC:
363
ECHOBASE:
EB0761
OU-MICROARRAY:
b0242
PortEco:
proB
STRING:
511145.b0242
COLOMBOS: proB


Product      
Name: glutamate 5-kinase
Synonym(s): ProB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 39.056
Isoelectric point: 6.517
Motif(s):
 
Type Positions Sequence
275 -> 353 AGEITVDEGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYE
276 -> 350 GEITVDEGATAAILERGSSLLPKGIKSVTGNFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAIL
211 -> 217 TGGMSTK
6 -> 234 TLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLDNNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIA
143 -> 143 E

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.4 - proline
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0016301 - kinase activity
GO:0003723 - RNA binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004349 - glutamate 5-kinase activity
GO:0000287 - magnesium ion binding
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
GO:1901973 - proline binding
biological_process GO:0006561 - proline biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0016310 - phosphorylation
GO:0055129 - L-proline biosynthetic process
External database links:  
ECOCYC:
GLUTKIN-MONOMER
ECOLIWIKI:
b0242
INTERPRO:
IPR041739
INTERPRO:
IPR036393
INTERPRO:
IPR019797
INTERPRO:
IPR015947
INTERPRO:
IPR011529
INTERPRO:
IPR005715
INTERPRO:
IPR002478
INTERPRO:
IPR036974
INTERPRO:
IPR001048
INTERPRO:
IPR001057
MODBASE:
P0A7B5
PDB:
2W21
PDB:
2J5V
PDB:
2J5T
PFAM:
PF00696
PFAM:
PF01472
PRIDE:
P0A7B5
PRINTS:
PR00474
PRODB:
PRO_000023597
PROSITE:
PS50890
PROSITE:
PS00902
REFSEQ:
NP_414777
SMART:
SM00359
SMR:
P0A7B5
UNIPROT:
P0A7B5


Operon      
Name: proBA         
Operon arrangement:
Transcription unit        Promoter
proBA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter proBp8 260216 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter proBp11 260303 forward Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_457 (cluster) 260345 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_458 260354 forward nd [RS-EPT-CBR] [2]
  promoter TSS_459 260358 forward nd [RS-EPT-CBR] [2]
  promoter TSS_460 (cluster) 260360 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_461 260370 forward nd [RS-EPT-CBR] [2]
  promoter TSS_462 260569 forward nd [RS-EPT-CBR] [2]
  promoter TSS_463 261229 forward nd [RS-EPT-CBR] [2]
  promoter TSS_464 261423 forward nd [RS-EPT-CBR] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB