RegulonDB RegulonDB 10.8: Gene Form
   

proC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dgcC proC yaiI yaiIp3 yaiIp3 yaiIp6 yaiIp6 yaiIp7 yaiIp7 proCp proCp TSS_496 TSS_496

Gene      
Name: proC    Texpresso search in the literature
Synonym(s): ECK0381, EG10769, Pro2, b0386, pro(3), pro3
Genome position(nucleotides): 404835 <-- 405644 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.57
External database links:  
ASAP:
ABE-0001338
CGSC:
362
ECHOBASE:
EB0762
MIM:
612940
MIM:
614438
OU-MICROARRAY:
b0386
PortEco:
proC
STRING:
511145.b0386
COLOMBOS: proC


Product      
Name: pyrroline-5-carboxylate reductase
Synonym(s): ProC
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.145
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
4 -> 99 KIGFIGCGNMGKAILGGLIASGQVLPGQIWVYTPSPDKVAALHDQFGINAAESAQEVAQIADIIFAAVKPGIMIKVLSEITSSLNKDSLVVSIAAG
163 -> 266 PMIHPVVGVSGSSPAYVFMFIEAMADAAVLGGMPRAQAYKFAAQAVMGSAKMVLETGEHPGALKDMVCSPGGTTIEAVRVLEEKGFRAAVIEAMTKCMEKSEKL

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.5 - biosynthesis of building blocks --> 1.5.1 - amino acids --> 1.5.1.4 - proline
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0016491 - oxidoreductase activity
GO:0004735 - pyrroline-5-carboxylate reductase activity
GO:0042802 - identical protein binding
biological_process GO:0006561 - proline biosynthetic process
GO:0008652 - cellular amino acid biosynthetic process
GO:0055114 - oxidation-reduction process
GO:0055129 - L-proline biosynthetic process
External database links:  
DIP:
DIP-47863N
ECOCYC:
PYRROLINECARBREDUCT-MONOMER
ECOLIWIKI:
b0386
INTERPRO:
IPR008927
INTERPRO:
IPR036291
INTERPRO:
IPR029036
INTERPRO:
IPR028939
INTERPRO:
IPR000304
MODBASE:
P0A9L8
PANTHER:
PTHR11645
PFAM:
PF14748
PFAM:
PF03807
PRIDE:
P0A9L8
PRODB:
PRO_000023598
PROSITE:
PS00521
REFSEQ:
NP_414920
SMR:
P0A9L8
UNIPROT:
P0A9L8


Operon      
Name: proC         
Operon arrangement:
Transcription unit        Promoter
proC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_496 405666 reverse nd [RS-EPT-CBR] [1]
  promoter yaiIp7 405698 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiIp6 405708 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yaiIp3 405723 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB